PDB entry 2a63

View 2a63 on RCSB PDB site
Description: Solution structure of a stably monomeric mutant of lambda Cro produced by substitutions in the ball-and-socket interface
Class: viral protein
Keywords: helix-turn-helix, monomer, ball-and-socket, VIRAL PROTEIN
Deposited on 2005-07-01, released 2006-06-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: regulatory protein cro
  Species: Enterobacteria phage lambda [TaxId:10710]
  Gene: cro
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03040 (0-65)
    • engineered (25)
    • engineered (32)
    • engineered (57)
  Domains in SCOPe 2.08: d2a63a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2a63A (A:)
  meqritlkdyamrfgqtktakdlgvqqsainkwihagrkifltinadgsvyaeevkpdps
  nkktta