PDB entry 2a5m

View 2a5m on RCSB PDB site
Description: NMR structure of murine gamma-S crystallin from joint refinement with SAXS data
Class: structural protein
Keywords: saxs, small-angle x-ray scattering, alignment, deuteration, liquid crystal, pf1, rdc, residual dipolar coupling, molecular fragment replacement, mfr, structural protein
Deposited on 2005-06-30, released 2005-07-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gamma crystallin s
    Species: Mus musculus [TaxId:10090]
    Gene: Crygs
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2a5ma1, d2a5ma2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2a5mA (A:)
    sktggkisfyedrnfqgrrydcdcdcadfrsylsrcnsirveggtwavyerpnfsghmyi
    lpqgeypeyqrwmglndrlgscravhlssggqakiqvfekgdfngqmyettedcpsimeq
    fhlreihsckvvegtwifyelpnyrgrqylldkkeyrkpvdwgaaspaiqsfrrive