PDB entry 2a3i

View 2a3i on RCSB PDB site
Description: Structural and Biochemical Mechanisms for the Specificity of Hormone Binding and Coactivator Assembly by Mineralocorticoid Receptor
Class: transferase
Keywords: transcription factor, TRANSFERASE
Deposited on 2005-06-24, released 2005-07-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.222
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mineralocorticoid receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: NR3C2, MCR, MLR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08235 (0-252)
      • engineered (76)
    Domains in SCOPe 2.06: d2a3ia_
  • Chain 'B':
    Compound: Nuclear receptor coactivator 1, residues 1430-1441
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: C0R, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2a3iA (A:)
raltpspvmvleniepeivyagydsskpdtaenllstlnrlagkqmiqvvkwakvlpgfk
nlpledqitliqyswmslssfalswrsykhtnsqflyfapdlvfneekmhqsamyelcqg
mhqislqfvrlqltfeeytimkvllllstipkdglksqaafeemrtnyikelrkmvtkcp
nnsgqswqrfyqltklldsmhdlvsdllefcfytfreshalkvefpamlveiisdqlpkv
esgnakplyfhrk

  • Chain 'B':
    No sequence available.