PDB entry 2a28
View 2a28 on RCSB PDB site
Description: Atomic-resolution crystal structure of the second SH3 domain of yeast Bzz1 determined from a pseudomerohedrally twinned crystal
Class: signaling protein
Keywords: SH3 domain, SIGNALING PROTEIN
Deposited on
2005-06-22, released
2006-09-12
The last revision prior to the SCOPe 2.05 freeze date was dated
2009-02-24, with a file datestamp of
2009-02-03.
Experiment type: XRAY
Resolution: 1.07 Å
R-factor: 0.112
AEROSPACI score: 0.98
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: BZZ1 protein
Species: Saccharomyces cerevisiae [TaxId:4932]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.05: d2a28a_ - Chain 'B':
Compound: BZZ1 protein
Species: Saccharomyces cerevisiae [TaxId:4932]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.05: d2a28b_ - Chain 'C':
Compound: BZZ1 protein
Species: Saccharomyces cerevisiae [TaxId:4932]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.05: d2a28c_ - Chain 'D':
Compound: BZZ1 protein
Species: Saccharomyces cerevisiae [TaxId:4932]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.05: d2a28d_ - Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>2a28A (A:)
gameaiyayeaqgddeisidpgdiitvirgddgsgwtygecdglkglfptsyck
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>2a28B (B:)
gameaiyayeaqgddeisidpgdiitvirgddgsgwtygecdglkglfptsyck
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>2a28C (C:)
gameaiyayeaqgddeisidpgdiitvirgddgsgwtygecdglkglfptsyck
- Chain 'D':
Sequence; same for both SEQRES and ATOM records: (download)
>2a28D (D:)
gameaiyayeaqgddeisidpgdiitvirgddgsgwtygecdglkglfptsyck