PDB entry 2a1w

View 2a1w on RCSB PDB site
Description: Anti-cocaine antibody 7.5.21, crystal form I
Class: immune system
Keywords: immune system
Deposited on 2005-06-21, released 2005-06-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.188
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: immunoglobulin heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2A1W (0-224)
    Domains in SCOPe 2.06: d2a1wh1
  • Chain 'I':
    Compound: immunoglobulin heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2A1W (0-224)
    Domains in SCOPe 2.06: d2a1wi1
  • Chain 'L':
    Compound: immunoglobulin light chain kappa
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2A1W (0-215)
    Domains in SCOPe 2.06: d2a1wl1, d2a1wl2
  • Chain 'M':
    Compound: immunoglobulin light chain kappa
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2A1W (0-215)
    Domains in SCOPe 2.06: d2a1wm1, d2a1wm2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2a1wH (H:)
    dvklvesggglvkpggslrlscaasgftfrnygmswvrqtpekrlewvaaisgnslytsy
    pdsvkgrftisrdnaknnlylqmsslrsedtalyfcarhddyygkspyffdvwgagttvt
    assakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavl
    qsdlytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdc
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2a1wI (I:)
    dvklvesggglvkpggslrlscaasgftfrnygmswvrqtpekrlewvaaisgnslytsy
    pdsvkgrftisrdnaknnlylqmsslrsedtalyfcarhddyygkspyffdvwgagttvt
    assakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavl
    qsdlytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdc
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2a1wL (L:)
    dvlmtqsplslpvslgdqasiscrcsqsivksnghtylewylqkpgrspklliykvsnrf
    sgvpdrfsgsgsgtdftlrisrveaedlgvyycfqgshipwtfgggtkleskradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnr
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2a1wM (M:)
    dvlmtqsplslpvslgdqasiscrcsqsivksnghtylewylqkpgrspklliykvsnrf
    sgvpdrfsgsgsgtdftlrisrveaedlgvyycfqgshipwtfgggtkleskradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnr