PDB entry 2a1k

View 2a1k on RCSB PDB site
Description: RB69 single-stranded DNA binding protein core domain
Class: DNA binding protein
Keywords: Zn2+ binding subdomain, 5-stranded beta-sheet, OB fold, single-stranded DNA binding, DNA BINDING PROTEIN
Deposited on 2005-06-20, released 2006-05-09
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.236
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gp32 single stranded DNA binding protein
    Species: Enterobacteria phage RB69 [TaxId:12353]
    Gene: 32
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2a1ka_
  • Chain 'B':
    Compound: gp32 single stranded DNA binding protein
    Species: Enterobacteria phage RB69 [TaxId:12353]
    Gene: 32
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2a1kb_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2a1kA (A:)
    kgfssedkgewklkldasgngqavirflpaktddalpfailvnhgfkkngkwyietcsst
    hgdydscpvcqyiskndlyntnkteysqlkrktsywanilvvkdpqapdnegkvfkyrfg
    kkiwdkinamiavdtemgetpvdvtcpweganfvlkvkqvsgfsnydeskflnqsaipni
    ddesfqkelfeqmvdlsemtskdkfksfeelntkfnqvlgtaalggaaaaaas
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a1kA (A:)
    dkgewklkldasgngqavirflpaktddalpfailvnhgfkkngkwyietcssthgdyds
    cpvcqyiskndlyntnkteysqlkrktsywanilvvkdpqapdnegkvfkyrfgkkiwdk
    inamiavdtemgetpvdvtcpweganfvlkvkqvsgfsnydeskflnqsaipniddesfq
    kelfeqmvdlsemtskdkfksfeelntkfnqvlgt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2a1kB (B:)
    kgfssedkgewklkldasgngqavirflpaktddalpfailvnhgfkkngkwyietcsst
    hgdydscpvcqyiskndlyntnkteysqlkrktsywanilvvkdpqapdnegkvfkyrfg
    kkiwdkinamiavdtemgetpvdvtcpweganfvlkvkqvsgfsnydeskflnqsaipni
    ddesfqkelfeqmvdlsemtskdkfksfeelntkfnqvlgtaalggaaaaaas
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a1kB (B:)
    gewklkldasgngqavirflpaktddalpfailvnhgfkkngkwyietcssthgdydscp
    vcqyiskndlyntnkteysqlkrktsywanilvvkdpqapdnegkvfkyrfgkkiwdkin
    amiavdtemgetpvdvtcpweganfvlkvkqvsgfsnydeskflnqsaipniddesfqke
    lfeqmvdlsemtskdkfksfeelntkfnqvlg