PDB entry 2a07

View 2a07 on RCSB PDB site
Description: Crystal Structure of Foxp2 bound Specifically to DNA.
Class: Transcription/DNA
Keywords: Forkhead, Double-Helix, Swapping, Homodimer, Monomer, Winged-Helix, Magnesium, Transcription/DNA COMPLEX
Deposited on 2005-06-16, released 2006-01-31
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.222
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5'-d(*ap*ap*cp*tp*ap*tp*gp*ap*ap*ap*cp*ap*ap*ap*tp*tp*tp*tp*cp*cp*t)-3'
    Species: synthetic, synthetic
  • Chain 'B':
    Compound: 5'-d(*tp*tp*ap*gp*gp*ap*ap*ap*ap*tp*tp*tp*gp*tp*tp*tp*cp*ap*tp*ap*g)-3'
    Species: synthetic, synthetic
  • Chain 'C':
    Compound: 5'-d(*ap*ap*cp*tp*ap*tp*gp*ap*ap*ap*cp*ap*ap*ap*tp*tp*tp*tp*cp*cp*t)-3'
    Species: synthetic, synthetic
  • Chain 'D':
    Compound: 5'-d(*tp*tp*ap*gp*gp*ap*ap*ap*ap*tp*tp*tp*gp*tp*tp*tp*cp*ap*tp*ap*g)-3'
    Species: synthetic, synthetic
  • Chain 'F':
    Compound: Forkhead box protein P2
    Species: Homo sapiens [TaxId:9606]
    Gene: FOXP2, CAGH44, TNRC10
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2a07f1
  • Chain 'G':
    Compound: Forkhead box protein P2
    Species: Homo sapiens [TaxId:9606]
    Gene: FOXP2, CAGH44, TNRC10
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2a07g_
  • Chain 'H':
    Compound: Forkhead box protein P2
    Species: Homo sapiens [TaxId:9606]
    Gene: FOXP2, CAGH44, TNRC10
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2a07h_
  • Chain 'I':
    Compound: Forkhead box protein P2
    Species: Homo sapiens [TaxId:9606]
    Gene: FOXP2, CAGH44, TNRC10
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2a07i_
  • Chain 'J':
    Compound: Forkhead box protein P2
    Species: Homo sapiens [TaxId:9606]
    Gene: FOXP2, CAGH44, TNRC10
    Database cross-references and differences (RAF-indexed):
    • Uniprot O15409 (0-End)
      • engineered (0)
    Domains in SCOPe 2.01: d2a07j_
  • Chain 'K':
    Compound: Forkhead box protein P2
    Species: Homo sapiens [TaxId:9606]
    Gene: FOXP2, CAGH44, TNRC10
    Database cross-references and differences (RAF-indexed):
    • Uniprot O15409 (0-End)
      • engineered (0)
    Domains in SCOPe 2.01: d2a07k_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2a07F (F:)
    ivrppftyatlirqaimessdrqltlneiyswftrtfayfrrnaatwknavrhnlslhkc
    fvrvenvkgavwtvdeveyqkrrsqkitgsptl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a07F (F:)
    vrppftyatlirqaimessdrqltlneiyswftrtfayfrrnaatwknavrhnlslhkcf
    vrvenvkgavwtvdeveyqkrr
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2a07G (G:)
    ivrppftyatlirqaimessdrqltlneiyswftrtfayfrrnaatwknavrhnlslhkc
    fvrvenvkgavwtvdeveyqkrrsqkitgsptl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a07G (G:)
    pftyatlirqaimessdrqltlneiyswftrtfayfrrnaatwknavrhnlslhkcfvrv
    envkgavwtvdeveyqkrr
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2a07H (H:)
    ivrppftyatlirqaimessdrqltlneiyswftrtfayfrrnaatwknavrhnlslhkc
    fvrvenvkgavwtvdeveyqkrrsqkitgsptl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a07H (H:)
    pftyatlirqaimessdrqltlneiyswftrtfayfrrnaatwknavrhnlslhkcfvrv
    envkgavwtvdeveyqkrr
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2a07I (I:)
    ivrppftyatlirqaimessdrqltlneiyswftrtfayfrrnaatwknavrhnlslhkc
    fvrvenvkgavwtvdeveyqkrrsqkitgsptl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a07I (I:)
    vrppftyatlirqaimessdrqltlneiyswftrtfayfrrnaatwknavrhnlslhkcf
    vrvenvkgavwtvdeveyqkr
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2a07J (J:)
    ivrppftyatlirqaimessdrqltlneiyswftrtfayfrrnaatwknavrhnlslhkc
    fvrvenvkgavwtvdeveyqkrrsqkitgsptl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a07J (J:)
    ivrppftyatlirqaimessdrqltlneiyswftrtfayfrrnaatwknavrhnlslhkc
    fvrvenvkgavwtvdeveyqkrr
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2a07K (K:)
    ivrppftyatlirqaimessdrqltlneiyswftrtfayfrrnaatwknavrhnlslhkc
    fvrvenvkgavwtvdeveyqkrrsqkitgsptl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a07K (K:)
    ivrppftyatlirqaimessdrqltlneiyswftrtfayfrrnaatwknavrhnlslhkc
    fvrvenvkgavwtvdeveyqkrr