PDB entry 2a03

View 2a03 on RCSB PDB site
Description: Superoxide dismutase protein from plasmodium berghei
Class: oxidoreductase
Keywords: STRUCTURAL GENOMICS, PSI, Protein Structure Initiative, Structural Genomics of Pathogenic Protozoa Consortium, SGPP, Oxidoreductase
Deposited on 2005-06-15, released 2005-06-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.33 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fe-superoxide dismutase homolog
    Species: Plasmodium berghei [TaxId:5821]
    Gene: PB000490.02.0
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2a03a1, d2a03a2
  • Chain 'B':
    Compound: Fe-superoxide dismutase homolog
    Species: Plasmodium berghei [TaxId:5821]
    Gene: PB000490.02.0
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2a03b1, d2a03b2
  • Heterogens: MN, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2a03A (A:)
    mahhhhhhmaitlpklkyalnalsphiseetlsfhynkhhagyvnklnglikdtplanks
    ltdilkestgaifnnaaqiwnhsfywdsmgpncggephgeikekiqedfgsfnnfkdqfs
    nvlcghfgsgwgwlalnknnklvilqthdagnpikentgipiltcdvwehayyidyrndr
    lsyvkawwnlvnwnfanenlknalnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a03A (A:)
    maitlpklkyalnalsphiseetlsfhynkhhagyvnklnglikdtplanksltdilkes
    tgaifnnaaqiwnhsfywdsmgpncggephgeikekiqedfgsfnnfkdqfsnvlcghfg
    sgwgwlalnknnklvilqthdagnpikentgipiltcdvwehayyidyrndrlsyvkaww
    nlvnwnfanenlknaln
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2a03B (B:)
    mahhhhhhmaitlpklkyalnalsphiseetlsfhynkhhagyvnklnglikdtplanks
    ltdilkestgaifnnaaqiwnhsfywdsmgpncggephgeikekiqedfgsfnnfkdqfs
    nvlcghfgsgwgwlalnknnklvilqthdagnpikentgipiltcdvwehayyidyrndr
    lsyvkawwnlvnwnfanenlknalnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a03B (B:)
    maitlpklkyalnalsphiseetlsfhynkhhagyvnklnglikdtplanksltdilkes
    tgaifnnaaqiwnhsfywdsmgpncggephgeikekiqedfgsfnnfkdqfsnvlcghfg
    sgwgwlalnknnklvilqthdagnpikentgipiltcdvwehayyidyrndrlsyvkaww
    nlvnwnfanenlknaln