PDB entry 250l

View 250l on RCSB PDB site
Description: the response of t4 lysozyme to large-to-small substitutions within the core and its relation to the hydrophobic effect
Deposited on 1997-10-22, released 1998-03-18
The last revision prior to the SCOP 1.55 freeze date was dated 1998-03-18, with a file datestamp of 1998-03-18.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.16
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.55: d250l__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >250l_ (-)
  mnifemlrideglrlkiykdtegyytigaghlltkspslnaakseldkaigrntngvatk
  deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslrm
  lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayk