PDB entry 208l

View 208l on RCSB PDB site
Description: mutant human lysozyme c77a
Class: complex (hydrolase (o-glycosyl)/cys)
Keywords: complex (hydrolase (o-glycosyl)/cys), mutant human lysozyme, hydrolase
Deposited on 1996-03-26, released 1996-10-14
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.18
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: lysozyme
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00695 (0-129)
    • engineered (76)
  Domains in SCOPe 2.02: d208la_
• Heterogens: CYS, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >208lA (A:)
  kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
  srywcndgktpgavnaahlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
  vrqyvqgcgv