PDB entry 208l

View 208l on RCSB PDB site
Description: mutant human lysozyme c77a
Class: complex (hydrolase (o-glycosyl)/cys)
Keywords: complex (hydrolase (o-glycosyl)/cys), mutant human lysozyme, hydrolase
Deposited on 1996-03-26, released 1996-10-14
The last revision prior to the SCOP 1.75 freeze date was dated 1996-10-14, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.18
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysozyme
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00695 (0-129)
      • engineered (76)
    Domains in SCOP 1.75: d208la_
  • Heterogens: CYS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >208lA (A:)
    kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
    srywcndgktpgavnaahlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
    vrqyvqgcgv