PDB entry 1zzy

View 1zzy on RCSB PDB site
Description: Crystal Structure of Thioredoxin Mutant L7V
Class: electron transport
Keywords: Alpha/Beta, ELECTRON TRANSPORT
Deposited on 2005-06-15, released 2005-07-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thioredoxin 1
    Species: Escherichia coli [TaxId:562]
    Gene: trxA, fipA, tsnC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00274 (Start-107)
      • engineered (6)
    Domains in SCOPe 2.07: d1zzya_
  • Chain 'B':
    Compound: Thioredoxin 1
    Species: Escherichia coli [TaxId:562]
    Gene: trxA, fipA, tsnC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00274 (Start-107)
      • engineered (6)
    Domains in SCOPe 2.07: d1zzyb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zzyA (A:)
    sdkiihvtddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklni
    dqnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zzyA (A:)
    kiihvtddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklnidq
    npgtapkygirgiptlllfkngevaatkvgalskgqlkefldanla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1zzyB (B:)
    sdkiihvtddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklni
    dqnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zzyB (B:)
    kiihvtddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklnidq
    npgtapkygirgiptlllfkngevaatkvgalskgqlkefldanla