PDB entry 1zzn

View 1zzn on RCSB PDB site
Description: Crystal structure of a group I intron/two exon complex that includes all catalytic metal ion ligands.
Class: structural protein/RNA
Keywords: RNA structure, ribozyme, self-splicing intron, Azoarcus, two-metal-ion mechanism, STRUCTURAL PROTEIN/RNA COMPLEX
Deposited on 2005-06-14, released 2005-08-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.37 Å
R-factor: 0.269
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: u1 small nuclear ribonucleoprotein a RNA binding domain
    Species: Homo sapiens [TaxId:9606]
    Gene: SNRPA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09012 (Start-97)
      • engineered (30)
      • engineered (35)
    Domains in SCOPe 2.06: d1zzna1
  • Chain 'B':
    Compound: 197-mer
    Species: synthetic, synthetic
  • Chain 'C':
    Compound: 5'-r(*ap*ap*gp*cp*cp*ap*cp*ap*cp*ap*ap*ap*cp*cp*ap*gp*ap*cp*gp*gp*cp*c)-3'
    Species: synthetic, synthetic
  • Chain 'D':
    Compound: 5'-r(*cp*ap*(5mu))-3'
    Species: synthetic, synthetic
  • Heterogens: MG, K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zznA (A:)
    mavpetrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifk
    evssatnalrsmqgfpfydkpmriqyaktdsdiiakmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zznA (A:)
    petrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevs
    satnalrsmqgfpfydkpmriqyaktdsdiiakmk
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.