PDB entry 1zzn

View 1zzn on RCSB PDB site
Description: Crystal structure of a group I intron/two exon complex that includes all catalytic metal ion ligands.
Class: structural protein/RNA
Keywords: RNA structure, ribozyme, self-splicing intron, Azoarcus, two-metal-ion mechanism, STRUCTURAL PROTEIN/RNA COMPLEX
Deposited on 2005-06-14, released 2005-08-30
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.37 Å
R-factor: 0.269
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: u1 small nuclear ribonucleoprotein a RNA binding domain
  Species: Homo sapiens [TaxId:9606]
  Gene: SNRPA
  Database cross-references and differences (RAF-indexed):
  • Uniprot P09012 (Start-97)
    • engineered (30)
    • engineered (35)
  Domains in SCOPe 2.04: d1zzna1
• Chain 'B':
  Compound: 197-mer
  Species: synthetic, synthetic
  
• Chain 'C':
  Compound: 5'-r(*ap*ap*gp*cp*cp*ap*cp*ap*cp*ap*ap*ap*cp*cp*ap*gp*ap*cp*gp*gp*cp*c)-3'
  Species: synthetic, synthetic
  
• Chain 'D':
  Compound: 5'-r(*cp*ap*(5mu))-3'
  Species: synthetic, synthetic
  
• Heterogens: MG, K, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1zznA (A:)
  mavpetrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifk
  evssatnalrsmqgfpfydkpmriqyaktdsdiiakmk
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1zznA (A:)
  petrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevs
  satnalrsmqgfpfydkpmriqyaktdsdiiakmk
  

  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.