PDB entry 1zzm

View 1zzm on RCSB PDB site
Description: Crystal structure of YJJV, TATD Homolog from Escherichia coli k12, at 1.8 A resolution
Class: structural genomics, unknown function
Keywords: yjjv, Escherichia coli, hydrolaze, zinc, crystal structure, PEG, Structural Genomics, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, UNKNOWN FUNCTION
Deposited on 2005-06-14, released 2005-06-28
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.171
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative deoxyribonuclease yjjV
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1zzma1
  • Heterogens: ZN, P33, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zzmA (A:)
    micrfidthchfdfppfsgdeeaslqraaqagvgkiivpateaenfarvlalaenyqply
    aalglhpgmlekhsdvsleqlqqalerrpakvvavgeigldlfgddpqferqqwlldeql
    klakrydlpvilhsrrthdklamhlkrhdlprtgvvhgfsgslqqaerfvqlgykigvgg
    tityprasktrdviaklplasllletdapdmplngfqgqpnrpeqaarvfavlcelrrep
    adeiaqallnntytlfnvp