PDB entry 1zzm

View 1zzm on RCSB PDB site
Description: Crystal structure of YJJV, TATD Homolog from Escherichia coli k12, at 1.8 A resolution
Class: structural genomics, unknown function
Keywords: yjjv, Escherichia coli, hydrolaze, zinc, crystal structure, PEG, Structural Genomics, PSI, Protein Structure Initiative, New York Structural GenomiX Research Consortium, NYSGXRC
Deposited on 2005-06-14, released 2005-06-28
The last revision prior to the SCOP 1.73 freeze date was dated 2005-06-28, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.171
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: putative deoxyribonuclease yjjV
  Species: Escherichia coli
  Database cross-references and differences (RAF-indexed):
  • Uniprot P39408 (0-258)
  Domains in SCOP 1.73: d1zzma1
• Heterogens: ZN, P33, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1zzmA (A:)
  micrfidthchfdfppfsgdeeaslqraaqagvgkiivpateaenfarvlalaenyqply
  aalglhpgmlekhsdvsleqlqqalerrpakvvavgeigldlfgddpqferqqwlldeql
  klakrydlpvilhsrrthdklamhlkrhdlprtgvvhgfsgslqqaerfvqlgykigvgg
  tityprasktrdviaklplasllletdapdmplngfqgqpnrpeqaarvfavlcelrrep
  adeiaqallnntytlfnvp