PDB entry 1zzh

View 1zzh on RCSB PDB site
Description: Structure of the fully oxidized di-heme cytochrome c peroxidase from R. capsulatus
Class: oxidoreductase
Keywords: cytochrome c peroxidase, heme groups, OXIDOREDUCTASE
Deposited on 2005-06-14, released 2005-11-29
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.249
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c peroxidase
    Species: RHODOBACTER CAPSULATUS [TaxId:1061]
    Database cross-references and differences (RAF-indexed):
    • PDB 1ZZH
    Domains in SCOPe 2.03: d1zzha1, d1zzha2
  • Chain 'B':
    Compound: cytochrome c peroxidase
    Species: RHODOBACTER CAPSULATUS [TaxId:1061]
    Database cross-references and differences (RAF-indexed):
    • PDB 1ZZH
    Domains in SCOPe 2.03: d1zzhb1, d1zzhb2
  • Chain 'C':
    Compound: cytochrome c peroxidase
    Species: RHODOBACTER CAPSULATUS [TaxId:1061]
    Database cross-references and differences (RAF-indexed):
    • PDB 1ZZH
    Domains in SCOPe 2.03: d1zzhc1, d1zzhc2
  • Chain 'D':
    Compound: cytochrome c peroxidase
    Species: RHODOBACTER CAPSULATUS [TaxId:1061]
    Database cross-references and differences (RAF-indexed):
    • PDB 1ZZH
    Domains in SCOPe 2.03: d1zzhd1, d1zzhd2
  • Heterogens: CA, ZN, HEC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zzhA (A:)
    edaalreeakglfevipmqapqladnntvtrdkidlgamlffdprmsksgvfscqschnv
    glggvdgletsighgwqkgprnaptalnavfnvaqfwdgrapdlaaqakgpvqagvemnn
    tpenlvatvqsmpgyveafakafpgqkdpisfdnfalaveafeatlitpnskfdqwlmga
    dgamsadekaglklfidtgcaachnginiggngyypfgvvekpgaevlpagdkgrfavta
    taddeyvfragplrnialtapyfhsgkvwdlreavsvmansqlgatlddtqvdqitaflg
    tltgeqpevvhpilpvrsaqtprpehmn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zzhA (A:)
    alreeakglfevipmqapvtrdkidlgamlffdprmsksgvfscqschnvglggvdglet
    sighgwqkgprnaptalnavfnvaqfwdgrapdlaaqamnntpenlvatvqsmpgyveaf
    akafpgqkdpisfdnfalaveafeatlitpnskfdqwlmgadgamsadekaglklfidtg
    caachnginiggngyypfgvvekpgrfavtataddeyvfragplrnialtapyfhsgkvw
    dlreavsvmansqlgatlddtqvdqitaflgtltgeqpevvhpilpvrsaqtprpeh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1zzhB (B:)
    edaalreeakglfevipmqapqladnntvtrdkidlgamlffdprmsksgvfscqschnv
    glggvdgletsighgwqkgprnaptalnavfnvaqfwdgrapdlaaqakgpvqagvemnn
    tpenlvatvqsmpgyveafakafpgqkdpisfdnfalaveafeatlitpnskfdqwlmga
    dgamsadekaglklfidtgcaachnginiggngyypfgvvekpgaevlpagdkgrfavta
    taddeyvfragplrnialtapyfhsgkvwdlreavsvmansqlgatlddtqvdqitaflg
    tltgeqpevvhpilpvrsaqtprpehmn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zzhB (B:)
    alreeakglfevipmqapqntvtrdkidlgamlffdprmsksgvfscqschnvglggvdg
    letsighgwqkgprnaptalnavfnvaqfwdgrapdlaaqamnntpenlvatvqsmpgyv
    eafakafpgqkdpisfdnfalaveafeatlitpnskfdqwlmgadgamsadekaglklfi
    dtgcaachnginiggngyypfgvvekpgaevlpdkgrfavtataddeyvfragplrnial
    tapyfhsgkvwdlreavsvmansqlgatlddtqvdqitaflgtltgeqpevvhpilpvrs
    aqtprpeh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1zzhC (C:)
    edaalreeakglfevipmqapqladnntvtrdkidlgamlffdprmsksgvfscqschnv
    glggvdgletsighgwqkgprnaptalnavfnvaqfwdgrapdlaaqakgpvqagvemnn
    tpenlvatvqsmpgyveafakafpgqkdpisfdnfalaveafeatlitpnskfdqwlmga
    dgamsadekaglklfidtgcaachnginiggngyypfgvvekpgaevlpagdkgrfavta
    taddeyvfragplrnialtapyfhsgkvwdlreavsvmansqlgatlddtqvdqitaflg
    tltgeqpevvhpilpvrsaqtprpehmn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zzhC (C:)
    alreeakglfevipmqapqntvtrdkidlgamlffdprmsksgvfscqschnvglggvdg
    letsighgwqkgprnaptalnavfnvaqfwdgrapdlaaqamnntpenlvatvqsmpgyv
    eafakafpgqkdpisfdnfalaveafeatlitpnskfdqwlmgadgamsadekaglklfi
    dtgcaachnginiggngyypfgvvekpgaevlpagrfavtataddeyvfragplrnialt
    apyfhsgkvwdlreavsvmansqlgatlddtqvdqitaflgtltgeqpevvhpilpvrsa
    qtprpeh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1zzhD (D:)
    edaalreeakglfevipmqapqladnntvtrdkidlgamlffdprmsksgvfscqschnv
    glggvdgletsighgwqkgprnaptalnavfnvaqfwdgrapdlaaqakgpvqagvemnn
    tpenlvatvqsmpgyveafakafpgqkdpisfdnfalaveafeatlitpnskfdqwlmga
    dgamsadekaglklfidtgcaachnginiggngyypfgvvekpgaevlpagdkgrfavta
    taddeyvfragplrnialtapyfhsgkvwdlreavsvmansqlgatlddtqvdqitaflg
    tltgeqpevvhpilpvrsaqtprpehmn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zzhD (D:)
    alreeakglfevipmqapqvtrdkidlgamlffdprmsksgvfscqschnvglggvdgle
    tsighgwqkgprnaptalnavfnvaqfwdgrapdlaaqamnntpenlvatvqsmpgyvea
    fakafpgqkdpisfdnfalaveafeatlitpnskfdqwlmgadgamsadekaglklfidt
    gcaachnginiggngyypfgvvekpgrfavtataddeyvfragplrnialtapyfhsgkv
    wdlreavsvmansqlgatlddtqvdqitaflgtltgeqpevvhpilpvrsaqtprpeh