PDB entry 1zy2

View 1zy2 on RCSB PDB site
Description: Crystal structure of the phosphorylated receiver domain of the transcription regulator NtrC1 from Aquifex aeolicus
Class: transcription
Keywords: phosphorylated receiver domain, sigma-54 activator, two-component signaling, ntrc, transcription
Deposited on 2005-06-09, released 2005-08-16
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.03 Å
R-factor: 0.251
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: transcriptional regulator NtrC1
  Species: Aquifex aeolicus [TaxId:63363]
  Gene: NTRC1
  Database cross-references and differences (RAF-indexed):
  • Uniprot O67198 (0-135)
    • modified residue (50)
    • cloning artifact (136-139)
  Domains in SCOPe 2.01: d1zy2a1
• Chain 'B':
  Compound: transcriptional regulator NtrC1
  Species: Aquifex aeolicus [TaxId:63363]
  Gene: NTRC1
  Database cross-references and differences (RAF-indexed):
  • Uniprot O67198 (0-End)
    • modified residue (50)
• Heterogens: MG, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1zy2A (A:)
  mnvlvieddkvfrglleeylsmkgikvesaergkeaykllsekhfnvvlldlllpdvngl
  eilkwikerspetevivitghgtiktaveamkmgaydfltkpcmleeieltinkaiehrk
  lrkenellrrekdlkeklaaalehhhhhhh
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1zy2A (A:)
  mnvlvieddkvfrglleeylsmkgikvesaergkeaykllsekhfnvvlldlllpdvngl
  eilkwikerspetevivitghgtiktaveamkmgaydfltkpcmleeieltinkaiehrk
  lrkenellrrekdlkeklaa
  

  
  
• Chain 'B':
  No sequence available.