PDB entry 1zxn

View 1zxn on RCSB PDB site
Description: Human DNA topoisomerase IIa ATPase/ADP
Class: isomerase
Keywords: GHKL nucleotide-binding fold, ISOMERASE
Deposited on 2005-06-08, released 2005-08-23
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.51 Å
R-factor: 0.235
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA topoisomerase II, alpha isozyme
    Species: Homo sapiens [TaxId:9606]
    Gene: TOP2A, TOP2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1zxna1, d1zxna2
  • Chain 'B':
    Compound: DNA topoisomerase II, alpha isozyme
    Species: Homo sapiens [TaxId:9606]
    Gene: TOP2A, TOP2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1zxnb1, d1zxnb2
  • Chain 'C':
    Compound: DNA topoisomerase II, alpha isozyme
    Species: Homo sapiens [TaxId:9606]
    Gene: TOP2A, TOP2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1zxnc1, d1zxnc2
  • Chain 'D':
    Compound: DNA topoisomerase II, alpha isozyme
    Species: Homo sapiens [TaxId:9606]
    Gene: TOP2A, TOP2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1zxnd1, d1zxnd2
  • Heterogens: MG, SO4, ADP, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zxnA (A:)
    sveriyqkktqlehillrpdtyigsvelvtqqmwvydedvginyrevtfvpglykifdei
    lvnaadnkqrdpkmscirvtidpennlisiwnngkgipvvehkvekmyvpalifgqllts
    snydddekkvtggrngygaklcnifstkftvetasreykkmfkqtwmdnmgragemelkp
    fngedytcitfqpdlskfkmqsldkdivalmvrraydiagstkdvkvflngnklpvkgfr
    syvdmylkdkldetgnslkviheqvnhrwevcltmsekgfqqisfvnsiatskggrhvdy
    vadqivtklvdvvkkknkggvavkahqvknhmwifvnalienptfdsqtkenmtlqpksf
    gstcqlsekfikaaigcgivesilnwvkfkaqvqlnkkcs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zxnA (A:)
    sveriyqkktqlehillrpdtyigsvelvtqqmwvydedvginyrevtfvpglykifdei
    lvnaadnkqrdpkmscirvtidpennlisiwnngkgipvvehkvekmyvpalifgqllts
    snydddekkvtggrngygaklcnifstkftvetasreykkmfkqtwmdnmgragemelkp
    fngedytcitfqpdlskfkmqsldkdivalmvrraydiagstkdvkvflngnklpvkgfr
    syvdmylkviheqvnhrwevcltmsekgfqqisfvnsiatskggrhvdyvadqivtklvh
    qvknhmwifvnalienptfdsqtkenmtlqpksfgstcqlsekfikaaigivesilnwvk
    fkaqvq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1zxnB (B:)
    sveriyqkktqlehillrpdtyigsvelvtqqmwvydedvginyrevtfvpglykifdei
    lvnaadnkqrdpkmscirvtidpennlisiwnngkgipvvehkvekmyvpalifgqllts
    snydddekkvtggrngygaklcnifstkftvetasreykkmfkqtwmdnmgragemelkp
    fngedytcitfqpdlskfkmqsldkdivalmvrraydiagstkdvkvflngnklpvkgfr
    syvdmylkdkldetgnslkviheqvnhrwevcltmsekgfqqisfvnsiatskggrhvdy
    vadqivtklvdvvkkknkggvavkahqvknhmwifvnalienptfdsqtkenmtlqpksf
    gstcqlsekfikaaigcgivesilnwvkfkaqvqlnkkcs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zxnB (B:)
    sveriyqkktqlehillrpdtyigsvelvtqqmwvydedvginyrevtfvpglykifdei
    lvnaadnkqrdpkmscirvtidpennlisiwnngkgipvvehkvekmyvpalifgqllts
    snydddekkvtggrngygaklcnifstkftvetasreykkmfkqtwmdnmgragemelkp
    fngedytcitfqpdlskfkmqsldkdivalmvrraydiagstkdvkvflngnklpvkgfr
    syvdmylkkviheqvnhrwevcltmsekgfqqisfvnsiatskggrhvdyvadqivtklv
    dvvkkkkahqvknhmwifvnalienptfdsqtkenmtlqpksfgstcqlsekfikaaigc
    givesilnwvkfkaqvqln
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1zxnC (C:)
    sveriyqkktqlehillrpdtyigsvelvtqqmwvydedvginyrevtfvpglykifdei
    lvnaadnkqrdpkmscirvtidpennlisiwnngkgipvvehkvekmyvpalifgqllts
    snydddekkvtggrngygaklcnifstkftvetasreykkmfkqtwmdnmgragemelkp
    fngedytcitfqpdlskfkmqsldkdivalmvrraydiagstkdvkvflngnklpvkgfr
    syvdmylkdkldetgnslkviheqvnhrwevcltmsekgfqqisfvnsiatskggrhvdy
    vadqivtklvdvvkkknkggvavkahqvknhmwifvnalienptfdsqtkenmtlqpksf
    gstcqlsekfikaaigcgivesilnwvkfkaqvqlnkkcs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zxnC (C:)
    sveriyqkktqlehillrpdtyigsvelvtqqmwvydedvginyrevtfvpglykifdei
    lvnaadnkqrdpkmscirvtidpennlisiwnngkgipvvehkvekmyvpalifgqllts
    snyddkvtggrngygaklcnifstkftvetasreykkmfkqtwmdnmgragemelkpfng
    edytcitfqpdlskfkmqsldkdivalmvrraydiagstkdvkvflngnklpvkgfrsyv
    dmylkviheqvnhrwevcltmsekgfqqisfvnsiatskggrhvdyvadqivtklvdvvk
    kknkggvavkahqvknhmwifvnalienptfdsqtkenmtlqpksfgstcqlsekfikaa
    igcgivesilnwvkfkaqvqlnkk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1zxnD (D:)
    sveriyqkktqlehillrpdtyigsvelvtqqmwvydedvginyrevtfvpglykifdei
    lvnaadnkqrdpkmscirvtidpennlisiwnngkgipvvehkvekmyvpalifgqllts
    snydddekkvtggrngygaklcnifstkftvetasreykkmfkqtwmdnmgragemelkp
    fngedytcitfqpdlskfkmqsldkdivalmvrraydiagstkdvkvflngnklpvkgfr
    syvdmylkdkldetgnslkviheqvnhrwevcltmsekgfqqisfvnsiatskggrhvdy
    vadqivtklvdvvkkknkggvavkahqvknhmwifvnalienptfdsqtkenmtlqpksf
    gstcqlsekfikaaigcgivesilnwvkfkaqvqlnkkcs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zxnD (D:)
    sveriyqkktqlehillrpdtyigsvelvtqqmwvydedvginyrevtfvpglykifdei
    lvnaadnkqrdpkmscirvtidpennlisiwnngkgipvvehkvekmyvpalifgqllts
    snydddekkvtggrngygaklcnifstkftvetasreykkmfkqtwmdnmgragemelkp
    fngedytcitfqpdlskfkmqsldkdivalmvrraydiagstkdvkvflngnklpvkgfr
    syvdmylkkviheqvnhrwevcltmsekgfqqisfvnsiatskggrhvdyvadqivtklv
    dvvkkahqvknhmwifvnalienptfdtkenmtlqpksfgstcqlsekfikaaigcgivw
    vkfkaqvqlnk