PDB entry 1zxm

View 1zxm on RCSB PDB site
Description: Human Topo IIa ATPase/AMP-PNP
Class: isomerase
Keywords: GHKL nucleotide-binding fold, ISOMERASE
Deposited on 2005-06-08, released 2005-08-23
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.87 Å
R-factor: 0.22
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA topoisomerase II, alpha isozyme
    Species: Homo sapiens [TaxId:9606]
    Gene: TOP2A, TOP2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1zxma1, d1zxma2
  • Chain 'B':
    Compound: DNA topoisomerase II, alpha isozyme
    Species: Homo sapiens [TaxId:9606]
    Gene: TOP2A, TOP2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1zxmb1, d1zxmb2
  • Heterogens: MG, ANP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zxmA (A:)
    sveriyqkktqlehillrpdtyigsvelvtqqmwvydedvginyrevtfvpglykifdei
    lvnaadnkqrdpkmscirvtidpennlisiwnngkgipvvehkvekmyvpalifgqllts
    snydddekkvtggrngygaklcnifstkftvetasreykkmfkqtwmdnmgragemelkp
    fngedytcitfqpdlskfkmqsldkdivalmvrraydiagstkdvkvflngnklpvkgfr
    syvdmylkdkldetgnslkviheqvnhrwevcltmsekgfqqisfvnsiatskggrhvdy
    vadqivtklvdvvkkknkggvavkahqvknhmwifvnalienptfdsqtkenmtlqpksf
    gstcqlsekfikaaigcgivesilnwvkfkaqvqlnkkcs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zxmA (A:)
    sveriyqkktqlehillrpdtyigsvelvtqqmwvydedvginyrevtfvpglykifdei
    lvnaadnkqrdpkmscirvtidpennlisiwnngkgipvvehkvekmyvpalifgqllts
    snydddekkvtggrngygaklcnifstkftvetasreykkmfkqtwmdnmgragemelkp
    fngedytcitfqpdlskfkmqsldkdivalmvrraydiagstkdvkvflngnklpvkgfr
    syvdmylkdkldetgnslkviheqvnhrwevcltmsekgfqqisfvnsiatskggrhvdy
    vadqivtklvdvvkkknavkahqvknhmwifvnalienptfdsqtkenmtlqpksfgstc
    qlsekfikaaigc
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1zxmB (B:)
    sveriyqkktqlehillrpdtyigsvelvtqqmwvydedvginyrevtfvpglykifdei
    lvnaadnkqrdpkmscirvtidpennlisiwnngkgipvvehkvekmyvpalifgqllts
    snydddekkvtggrngygaklcnifstkftvetasreykkmfkqtwmdnmgragemelkp
    fngedytcitfqpdlskfkmqsldkdivalmvrraydiagstkdvkvflngnklpvkgfr
    syvdmylkdkldetgnslkviheqvnhrwevcltmsekgfqqisfvnsiatskggrhvdy
    vadqivtklvdvvkkknkggvavkahqvknhmwifvnalienptfdsqtkenmtlqpksf
    gstcqlsekfikaaigcgivesilnwvkfkaqvqlnkkcs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zxmB (B:)
    sveriyqkktqlehillrpdtyigsvelvtqqmwvydedvginyrevtfvpglykifdei
    lvnaadnkqrdpkmscirvtidpennlisiwnngkgipvvehkvekmyvpalifgqllts
    snydddekkvtggrngygaklcnifstkftvetasreykkmfkqtwmdnmgragemelkp
    fngedytcitfqpdlskfkmqsldkdivalmvrraydiagstkdvkvflngnklpvkgfr
    syvdmylkdkldetgnslkviheqvnhrwevcltmsekgfqqisfvnsiatskggrhvdy
    vadqivtklvdvvkkknvkahqvknhmwifvnalienptfdsqtkenmtlqpksfgstcq
    lsekfikaaigcgivesi