PDB entry 1zwz

View 1zwz on RCSB PDB site
Description: Structural comparison of Yeast snoRNP and splicesomal protein snu13p with its homologs
Class: RNA binding protein
Keywords: Protein RNA complex, rRNA modification, mRNA splicing, RNA BINDING PROTEIN
Deposited on 2005-06-06, released 2006-05-23
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.184
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Snu13p
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1zwza1
  • Chain 'B':
    Compound: Snu13p
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1zwzb1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zwzA (A:)
    msapnpkafpladaaltqqildvvqqaanlrqlkkganeatktlnrgisefiimaadcep
    ieillhlpllcedknvpyvfvpsrvalgracgvsrpviaasittndasaiktqiyavkdk
    ietlli
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zwzA (A:)
    sapnpkafpladaaltqqildvvqqaanlrqlkkganeatktlnrgisefiimaadcepi
    eillhlpllcedknvpyvfvpsrvalgracgvsrpviaasittndasaiktqiyavkdki
    etlli
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1zwzB (B:)
    msapnpkafpladaaltqqildvvqqaanlrqlkkganeatktlnrgisefiimaadcep
    ieillhlpllcedknvpyvfvpsrvalgracgvsrpviaasittndasaiktqiyavkdk
    ietlli
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zwzB (B:)
    sapnpkafpladaaltqqildvvqqaanlrqlkkganeatktlnrgisefiimaadcepi
    eillhlpllcedknvpyvfvpsrvalgracgvsrpviaasittndasaiktqiyavkdki
    etlli