PDB entry 1zww

View 1zww on RCSB PDB site
Description: Crystal structure of endophilin-A1 BAR domain
Class: transferase
Keywords: coiled coil
Deposited on 2005-06-06, released 2005-08-02
The last revision prior to the SCOP 1.75 freeze date was dated 2005-08-02, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.251
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sh3-containing grb2-like protein 2
    Species: MUS MUSCULUS
    Gene: Sh3gl2, Sh3d2a
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1zwwa1
  • Chain 'B':
    Compound: sh3-containing grb2-like protein 2
    Species: MUS MUSCULUS
    Gene: Sh3gl2, Sh3d2a
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1zwwb1
  • Heterogens: CD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zwwA (A:)
    msvaglkkqfhkatqkvsekvggaegtkldddfkemerkvdvtsravmeimtktieylqp
    npasraklsmintmskirgqekgpgypqaeallaeamlkfgrelgddcnfgpalgevgea
    mrelsevkdsldmevkqnfidplqnlhdkdlreiqhhlkklegrrldfgykkkrqgkipd
    eelrqalekfdeskeiaessmfnllemdieqvsqlsalvqaqleyhkqavqilqqvtvrl
    eerirqassqprreyq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zwwA (A:)
    tkldddfkemerkvdvtsravmeimtktieylqpnpasrpqaeallaeamlkfgrelgdd
    cnfgpalgevgeamrelsevkdsldmevkqnfidplqnlhdkdlreiqhhlkklegrrld
    fgykkkrqgkipdeelrqalekfdeskeiaessmfnllemdieqvsqlsalvqaqleyhk
    qavqilqqvtvrleerirq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1zwwB (B:)
    msvaglkkqfhkatqkvsekvggaegtkldddfkemerkvdvtsravmeimtktieylqp
    npasraklsmintmskirgqekgpgypqaeallaeamlkfgrelgddcnfgpalgevgea
    mrelsevkdsldmevkqnfidplqnlhdkdlreiqhhlkklegrrldfgykkkrqgkipd
    eelrqalekfdeskeiaessmfnllemdieqvsqlsalvqaqleyhkqavqilqqvtvrl
    eerirqassqprreyq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zwwB (B:)
    kldddfkemerkvdvtsravmeimtktieylqpnpasrakpqaeallaeamlkfgrelgd
    dcnfgpalgevgeamrelsevkdsldmevkqnfidplqnlhdkdlreiqhhlkklegrrl
    dfgykkkrdeelrqalekfdeskeiaessmfnllemdieqvsqlsalvqaqleyhkqavq
    ilqqvtvrleerirqa