PDB entry 1zwo

View 1zwo on RCSB PDB site
Description: NMR structure of murine gamma-S crystallin
Class: Structural Protein
Keywords: alignment, deuteration, liquid crystal, Pf1, relaxation, RDC, residual dipolar coupling, molecular fragment replacement, MFR, Structural Protein
Deposited on 2005-06-04, released 2005-07-05
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gamma crystallin s
    Species: Mus musculus [TaxId:10090]
    Gene: Crygs
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1zwoa1, d1zwoa2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zwoA (A:)
    sktggkisfyedrnfqgrrydcdcdcadfrsylsrcnsirveggtwavyerpnfsghmyi
    lpqgeypeyqrwmglndrlgscravhlssggqakiqvfekgdfngqmyettedcpsimeq
    fhlreihsckvvegtwifyelpnyrgrqylldkkeyrkpvdwgaaspaiqsfrrive