PDB entry 1zvn
View 1zvn on RCSB PDB site
Description: Crystal structure of chick MN-cadherin EC1
Class: cell adhesion
Keywords: cadherin, CELL ADHESION
Deposited on
2005-06-02, released
2006-04-25
The last revision prior to the SCOPe 2.08 freeze date was dated
2013-04-10, with a file datestamp of
2013-04-05.
Experiment type: XRAY
Resolution: 2.16 Å
R-factor: 0.173
AEROSPACI score: 0.43
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Cadherin 1
Species: Gallus gallus [TaxId:9031]
Gene: MNcadherin
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1zvna1, d1zvna2 - Chain 'B':
Compound: Cadherin 1
Species: Gallus gallus [TaxId:9031]
Gene: MNcadherin
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1zvnb1, d1zvnb2 - Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1zvnA (A:)
sgwvwnqffvleeytgtdplyvgklhsdmdrgdgsikyilsgegagivftiddttgdiha
iqrldreersqytlraqaldrrtgrpmepesefiikiqd
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1zvnB (B:)
sgwvwnqffvleeytgtdplyvgklhsdmdrgdgsikyilsgegagivftiddttgdiha
iqrldreersqytlraqaldrrtgrpmepesefiikiqd