PDB entry 1zvd

View 1zvd on RCSB PDB site
Description: Regulation of Smurf2 Ubiquitin Ligase Activity by Anchoring the E2 to the HECT domain
Class: ligase
Keywords: Ubiquitin LigaseCatalytic Mechanism,x-ray crystal structure, TGFbeta, LIGASE
Deposited on 2005-06-01, released 2005-08-09
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-09-28, with a file datestamp of 2011-09-23.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.202
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Smad ubiquitination regulatory factor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: SMURF2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1zvda_
  • Heterogens: NA, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zvdA (A:)
    krdlvqklkilrqelsqqqpqaghcrievsreeifeesyrqvmkmrpkdlwkrlmikfrg
    eegldyggvarewlyllshemlnpyyglfqysrddiytlqinpdsavnpehlsyfhfvgr
    imgmavfhghyidggftlpfykqllgksitlddmelvdpdlhnslvwilenditgvldht
    fcvehnaygeiiqhelkpngksipvneenkkeyvrlyvnwrflrgieaqflalqkgfnev
    ipqhllktfdekeleliicglgkidvndwkvntrlkhctpdsnivkwfwkaveffdeerr
    arllqfvtgssrvplqgfkalqgaagprlftihqidactnnlpkahtcfnridippyesy
    eklyeklltaieetcgfave
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zvdA (A:)
    krdlvqklkilrqelsqqqpqaghcrievsreeifeesyrqvmkmrpkdlwkrlmikfrg
    eegldyggvarewlyllshemlnpyyglfqysrddiytlqinpdsavnpehlsyfhfvgr
    imgmavfhghyidggftlpfykqllgksitlddmelvdpdlhnslvwilenditgvldht
    fcvehnaygeiiqhelkpngksipvneenkkeyvrlyvnwrflrgieaqflalqkgfnev
    ipqhllktfdekeleliicglgkidvndwkvntrlkhctpdsnivkwfwkaveffdeerr
    arllqfvtgssrvplqgfkalqgaagprlftihqidactnnlpkahtcfnridippyesy
    eklyeklltaiee