PDB entry 1ztz

View 1ztz on RCSB PDB site
Description: Crystal structure of HIV protease- metallacarborane complex
Class: hydrolase
Keywords: rational drug design; HIV protease inhibitors; aspartic proteases; carboranes; metallacarboranes, HYDROLASE
Deposited on 2005-05-28, released 2005-11-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protease retropepsin
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: gag-pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03367 (0-98)
    • engineered (6)
    • engineered (32)
    • engineered (62)
  Domains in SCOPe 2.08: d1ztza_
• Chain 'B':
  Compound: protease retropepsin
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: gag-pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03367 (0-98)
    • engineered (6)
    • engineered (32)
    • engineered (62)
  Domains in SCOPe 2.08: d1ztzb_
• Chain 'P':
  Compound: autoproteolytic tetrapeptide
  Database cross-references and differences (RAF-indexed):
  • PDB 1ZTZ (0-3)
• Heterogens: CB5, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ztzA (A:)
  pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
  qiiieicghkaigtvlvgptpvniigrnlltqigctlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ztzB (B:)
  pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
  qiiieicghkaigtvlvgptpvniigrnlltqigctlnf
  

  
  
• Chain 'P':
  No sequence available.