PDB entry 1zs5

View 1zs5 on RCSB PDB site
Description: Structure-based evaluation of selective and non-selective small molecules that block HIV-1 TAT and PCAF association
Class: transferase
Keywords: bromodomain, histone-acetyltransferase, nmr-structure chemical ligand
Deposited on 2005-05-23, released 2006-05-23
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone acetyltransferase PCAF
    Species: Homo sapiens [TaxId:9606]
    Gene: PCAF
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92831 (4-117)
      • cloning artifact (0-3)
    Domains in SCOPe 2.05: d1zs5a_
  • Heterogens: MIB

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zs5A (A:)
    gshmskeprdpdqlystlksilqqvkshqsawpfmepvkrteapgyyevirfpmdlktms
    erlknryyvskklfmadlqrvftnckeynppeseyykcanilekfffskikeaglidk