PDB entry 1zs0

View 1zs0 on RCSB PDB site
Description: Crystal structure of the complex between MMP-8 and a phosphonate inhibitor (S-enantiomer)
Class: hydrolase
Keywords: phosphonic inhibitor, sulphonamide junction, stereoselective inhibition, Hydrolase
Deposited on 2005-05-23, released 2006-05-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.56 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neutrophil collagenase
    Species: Homo sapiens [TaxId:9606]
    Gene: MMP8, CLG1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1zs0a_
  • Heterogens: CA, ZN, EIN, MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zs0A (A:)
    mltpgnpkwertnltyrirnytpqlseaeveraikdafelwsvaspliftrisqgeadin
    iafyqrdhgdnspfdgpngilahafqpgqgiggdahfdaeetwtntsanynlflvaahef
    ghslglahssdpgalmypnyafretsnyslpqddidgiqaiyg