PDB entry 1zrp

View 1zrp on RCSB PDB site
Description: solution-state structure by nmr of zinc-substituted rubredoxin from the marine hyperthermophilic archaebacterium pyrococcus furiosus
Class: electron transport
Keywords: electron transport
Deposited on 1992-07-10, released 1993-10-31
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rubredoxin
    Species: PYROCOCCUS FURIOSUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1zrpa_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zrpA (A:)
    akwvckicgyiydedagdpdngispgtkfeelpddwvcpicgapksefekled