PDB entry 1zqy

View 1zqy on RCSB PDB site
Description: dna polymerase beta (pol b) (e.c.2.7.7.7), 31-kd domain; soaked in the presence of mgcl2 (50 millimolar)
Deposited on 1996-04-19, released 1996-11-15
The last revision prior to the SCOP 1.63 freeze date was dated 1996-11-15, with a file datestamp of 1996-11-15.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.198
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1zqy_ (-)
    ddtsssinfltrvtgigpsaarklvdegiktledlrknedklnhhqriglkyfedfekri
    preemlqmqdivlnevkkldpeyiatvcgsfrrgaessgdmdvllthpnftsesskqpkl
    lhrvveqlqkvrfitdtlskgetkfmgvcqlpsendeneyphrridirlipkdqyycgvl
    yftgsdifnknmrahalekgftineytirplgvtgvageplpvdseqdifdyiqwryrep
    kdrse
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zqy_ (-)
    ddtsssinfltrvtgigpsaarklvdegiktledlrknedklnhhqriglkyfedfekri
    preemlqmqdivlnevkkldpeyiatvcgsfrrgaessgdmdvllthpnftsesskqpkl
    lhrvveqlqkvrfitdtlskgetkfmgvcqlpseneyphrridirlipkdqyycgvlyft
    gsdifnknmrahalekgftineytirplgvtgvageplpvdseqdifdyiqwryrepkdr
    se