PDB entry 1zqu

View 1zqu on RCSB PDB site
Description: dna polymerase beta (pol b) (e.c.2.7.7.7), 31-kd domain; soaked in the presence of artificial mother liquor
Deposited on 1996-04-19, released 1996-11-15
The last revision prior to the SCOP 1.67 freeze date was dated 1996-11-15, with a file datestamp of 1996-11-15.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.198
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1zqu_ (-)
    irqddtsssinfltrvtgigpsaarklvdegiktledlrknedklnhhqriglkyfedfe
    kripreemlqmqdivlnevkkldpeyiatvcgsfrrgaessgdmdvllthpnftsesskq
    pkllhrvveqlqkvrfitdtlskgetkfmgvcqlpsendeneyphrridirlipkdqyyc
    gvlyftgsdifnknmrahalekgftineytirplgvtgvageplpvdseqdifdyiqwry
    repkdrse
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zqu_ (-)
    ddtsssinfltrvtgigpsaarklvdegiktledlrknedklnhhqriglkyfedfekri
    preemlqmqdivlnevkkldpeyiatvcgsfrrgaessgdmdvllthpnftsesskqpkl
    lhrvveqlqkvrfitdtlskgetkfmgvcqlpseneyphrridirlipkdqyycgvlyft
    gsdifnknmrahalekgftineytirplgvtgvageplpvdseqdifdyiqwryrepkdr
    se