PDB entry 1zpa

View 1zpa on RCSB PDB site
Description: HIV Protease with Scripps AB-3 Inhibitor
Class: hydrolase
Keywords: protease, retroviral
Deposited on 2005-05-16, released 2005-05-31
The last revision prior to the SCOP 1.73 freeze date was dated 2005-12-13, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.02 Å
R-factor: 0.197
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Pol polyprotein
  Species: Human immunodeficiency virus 1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03368 (0-98)
    • variant (6)
  Domains in SCOP 1.73: d1zpaa1
• Heterogens: A83, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1zpaA (A:)
  pqitlwkrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
  qilieicghkaigtvlvgptpvniigrnlltqigctlnf