PDB entry 1zox

View 1zox on RCSB PDB site
Description: CLM-1 Mouse Myeloid Receptor Extracellular Domain
Class: structural genomics, unknown function
Keywords: Ig-Superfamily, Ig-V, NKp44-like, myeloid Ig-like receptor, Structural Genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2005-05-15, released 2005-05-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: clm-1
    Species: Mus musculus [TaxId:10090]
    Gene: CLM-1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1zoxa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zoxA (A:)
    medpvtgpeevsgqeqgsltvqcrytsgwkdykkywcqgvpqrscktlvetdaseqlvkk
    nrvsirdnqrdfiftvtmedlrmsdagiywcgitkggldpmfkvtvnigpvpt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zoxA (A:)
    edpvtgpeevsgqeqgsltvqcrytsgwkdykkywcqgvpqrscktlvetdaseqlvkkn
    rvsirdnqrdfiftvtmedlrmsdagiywcgitkggldpmfkvtvnigpv