PDB entry 1zn1

View 1zn1 on RCSB PDB site
Description: Coordinates of RRF fitted into Cryo-EM map of the 70S post-termination complex
Class: BIOSYNTHETIC/structural protein/RNA
Keywords: ribosome recycling factor, elongation factor G, 70S, post-termination complex
Deposited on 2005-05-11, released 2005-06-14
The last revision prior to the SCOP 1.75 freeze date was dated 2005-06-14, with a file datestamp of 2007-06-28.
Experiment type: EM
Resolution: 14.1 Å
R-factor: N/A
AEROSPACI score: -0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribosome recycling factor
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1zn1a1
  • Chain 'B':
    Compound: ribosomal 23S RNA
    Species: Escherichia coli
  • Chain 'C':
    Compound: ribosomal 16S RNA
    Species: Escherichia coli
  • Chain 'L':
    Compound: 30S ribosomal protein S12
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zn1A (A:)
    misdirkdaevrmdkcveafktqiskirtgraspslldgivveyygtptplrqlasvtve
    dsrtlkinvfdrsmspavekaimasdlglnpnsagsdirvplpplteerrkdltkivrge
    aeqarvavrnvrrdandkvkallkdkeisedddrrsqddvqkltdaaikkieaaladkea
    elmqf
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'L':
    No sequence available.