PDB entry 1zn0

View 1zn0 on RCSB PDB site
Description: Coordinates of RRF and EF-G fitted into Cryo-EM map of the 50S subunit bound with both EF-G (GDPNP) and RRF
Class: translation/biosynthetic protein/RNA
Keywords: ribosome recycling factor, elongation factor G, 50S subunit
Deposited on 2005-05-11, released 2005-06-14
The last revision prior to the SCOP 1.75 freeze date was dated 2005-06-14, with a file datestamp of 2007-06-28.
Experiment type: EM
Resolution: 15.5 Å
R-factor: N/A
AEROSPACI score: -0.14 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ribosome recycling factor
  Species: Escherichia coli
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A805 (0-184)
  Domains in SCOP 1.75: d1zn0a1
• Chain 'B':
  Compound: Elongation factor G
  Species: Escherichia coli
  
• Chain 'C':
  Compound: 16S ribosomal RNA
  Species: Escherichia coli
  

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1zn0A (A:)
  misdirkdaevrmdkcveafktqiskirtgraspslldgivveyygtptplrqlasvtve
  dsrtlkinvfdrsmspavekaimasdlglnpnsagsdirvplpplteerrkdltkivrge
  aeqarvavrnvrrdandkvkallkdkeisedddrrsqddvqkltdaaikkieaaladkea
  elmqf
  

  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.