PDB entry 1zmu

View 1zmu on RCSB PDB site
Description: Catalytic and ubiqutin-associated domains of MARK2/PAR-1: Wild type
Class: signaling protein,transferase
Keywords: serine/threonine protein kinase; mark; par-1; kin1; uba domain, signaling protein,transferase
Deposited on 2005-05-11, released 2006-02-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.199
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MAP/Microtubule affinity regulating kinase 2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: MARK2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1zmua_
  • Chain 'B':
    Compound: MAP/Microtubule affinity regulating kinase 2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: MARK2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1zmub_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zmuA (A:)
    gnsatsadeqphignyrllktigkgnfakvklarhiltgkevavkiidktqlnssslqkl
    frevrimkvlnhpnivklfevietektlylvmeyasggevfdylvahgrmkekearakfr
    qivsavqychqkfivhrdlkaenllldadmnikiadfgfsneftfgnkldtfcgsppyaa
    pelfqgkkydgpevdvwslgvilytlvsgslpfdgqnlkelrervlrgkyripfymstdc
    enllkkflilnpskrgtleqimkdrwmnvgheddelkpyveplpdykdprrtelmvsmgy
    treeiqdslvgqrynevmatylllgyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zmuA (A:)
    gnyrllktigkgakvklarhiltgkevavkiidktqlnssslqklfrevrimkvlnhpni
    vklfevietektlylvmeyasggevfdylvahgrmkekearakfrqivsavqychqkfiv
    hrdlkaenllldadmnikiagsppyaapelfqgkkydgpevdvwslgvilytlvsgslpf
    dgqnlkelrervlrgkyripfymstdcenllkkflilnpskrgtleqimkdrwmnvghed
    delkpyveplpdykdprrtelmvsmgytreeiqdslvgqrynevmatylllgy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1zmuB (B:)
    gnsatsadeqphignyrllktigkgnfakvklarhiltgkevavkiidktqlnssslqkl
    frevrimkvlnhpnivklfevietektlylvmeyasggevfdylvahgrmkekearakfr
    qivsavqychqkfivhrdlkaenllldadmnikiadfgfsneftfgnkldtfcgsppyaa
    pelfqgkkydgpevdvwslgvilytlvsgslpfdgqnlkelrervlrgkyripfymstdc
    enllkkflilnpskrgtleqimkdrwmnvgheddelkpyveplpdykdprrtelmvsmgy
    treeiqdslvgqrynevmatylllgyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zmuB (B:)
    phignyrllktigkgakvklarhiltgkevavkiidktqlnssslqklfrevrimkvlnh
    pnivklfevietektlylvmeyasggevfdylvahgrmkekearakfrqivsavqychqk
    fivhrdlkaenllldadmnikiagsppyaapelfqgkkydgpevdvwslgvilytlvsgs
    lpfdgqnlkelrervlrgkyripfymstdcenllkkflilnpskrgtleqimkdrwmnvg
    heddelkpyveplpdykdprrtelmvsmgytreeiqdslvgqrynevmatylllgy