PDB entry 1zm4

View 1zm4 on RCSB PDB site
Description: Structure of the eEF2-ETA-bTAD complex
Class: biosynthetic protein/transferase
Keywords: elongation factor, toxin, ADP-ribosylation
Deposited on 2005-05-10, released 2005-05-24
The last revision prior to the SCOP 1.75 freeze date was dated 2005-08-30, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.246
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Elongation factor 2
    Species: Saccharomyces cerevisiae
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32324 (Start-841)
      • modified residue (698)
    Domains in SCOP 1.75: d1zm4a1, d1zm4a2, d1zm4a3, d1zm4a4, d1zm4a5
  • Chain 'B':
    Compound: exotoxin a
    Species: Pseudomonas aeruginosa
    Database cross-references and differences (RAF-indexed):
    • GB AAB59097 (0-206)
    Domains in SCOP 1.75: d1zm4b1
  • Chain 'C':
    Compound: Elongation factor 2
    Species: Saccharomyces cerevisiae
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32324 (Start-841)
      • modified residue (698)
    Domains in SCOP 1.75: d1zm4c1, d1zm4c2, d1zm4c3, d1zm4c4, d1zm4c5
  • Chain 'D':
    Compound: exotoxin a
    Species: Pseudomonas aeruginosa
    Database cross-references and differences (RAF-indexed):
    • GB AAB59097 (0-206)
    Domains in SCOP 1.75: d1zm4d1
  • Chain 'E':
    Compound: Elongation factor 2
    Species: Saccharomyces cerevisiae
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32324 (Start-841)
      • modified residue (698)
    Domains in SCOP 1.75: d1zm4e1, d1zm4e2, d1zm4e3, d1zm4e4, d1zm4e5
  • Chain 'F':
    Compound: exotoxin a
    Species: Pseudomonas aeruginosa
    Database cross-references and differences (RAF-indexed):
    • GB AAB59097 (0-206)
    Domains in SCOP 1.75: d1zm4f1
  • Heterogens: TAD

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zm4A (A:)
    mvaftvdqmrslmdkvtnvrnmsviahvdhgkstltdslvqragiisaakagearftdtr
    kdeqergitikstaislysemsdedvkeikqktdgnsflinlidspghvdfssevtaalr
    vtdgalvvvdtiegvcvqtetvlrqalgerikpvvvinkvdrallelqvskedlyqtfar
    tvesvnvivstyadevlgdvqvypargtvafgsglhgwaftirqfatryakkfgvdkakm
    mdrlwgdsffnpktkkwtnkdtdaegkplerafnmfildpifrlftaimnfkkdeipvll
    ekleivlkgdekdlegkallkvvmrkflpaadallemivlhlpspvtaqayraeqlyegp
    addanciaikncdpkadlmlyvskmvptsdkgrfyafgrvfagtvksgqkvriqgpnyvp
    gkkddlfikaiqrvvlmmgrfvepiddcpagniiglvgidqfllktgtlttsetahnmkv
    mkfsvspvvqvavevknandlpklveglkrlsksdpcvltymsesgehivagtgelhlei
    clqdlehdhagvplkisppvvayretvesessqtalskspnkhnriylkaepideevsla
    iengiinprddfkararimaddygwdvtdarkiwcfgpdgngpnlvidqtkavqylheik
    dsvvaafqwatkegpifgeemrsvrvnildvtlhadaihrgggqiiptmrratyagflla
    dpkiqepvflveiqcpeqavggiysvlnkkrgqvvseeqrpgtplftvkaylpvnesfgf
    tgelrqatggqafpqmvfdhwstlgsdpldptskageivlaarkrhgmkeevpgwqeyyd
    kl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zm4A (A:)
    vaftvdqmrslmdkvtnvrnmsviahvdhgkstltdslvqragiisagitikstaislys
    emsdedvkeikqktdgnsflinlidspghvdfssevtaalrvtdgalvvvdtiegvcvqt
    etvlrqalgerikpvvvinkvdrallelqvskedlyqtfartvesvnvivstyadevlgd
    vqvypargtvafgsglhgwaftirqfatryakkfgvdkakmmdrlwgdsffnpktkkwtn
    kdtdaegkplerafnmfildpifrlftaimnfkkdeipvllekleivlkgdekdlegkal
    lkvvmrkflpaadallemivlhlpspvtaqayraeqlyegpaddanciaikncdpkadlm
    lyvskmvptsdkgrfyafgrvfagtvksgqkvriqgpnyvpgkkddlfikaiqrvvlmmg
    rfvepiddcpagniiglvgidqfllktgtlttsetahnmkvmkfsvspvvqvavevknan
    dlpklveglkrlsksdpcvltymsesgehivagtgelhleiclqdlehdhagvplkispp
    vvayretvesessqtalskspnkhnriylkaepideevslaiengiinprddfkararim
    addygwdvtdarkiwcfgpdgngpnlvidqtkavqylheikdsvvaafqwatkegpifge
    emrsvrvnildvtlhadaihrgggqiiptmrratyagflladpkiqepvflveiqcpeqa
    vggiysvlnkkrgqvvseeqrpgtplftvkaylpvnesfgftgelrqatggqafpqmvfd
    hwstlgsdpldptskageivlaarkrhgmkeevpgwqeyydkl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zm4B (B:)
    eflgdggdvsfstrgtqnwtverllqahrqleergyvfvgyhgtfleaaqsivfggvrar
    sqdldaiwrgfyiagdpalaygyaqdqepdargrirngallrvyvprsslpgfyrtsltl
    aapeaageverlighplplrldaitgpeeeggrletilgwplaertvvipsaiptdprnv
    ggdldpssipdkeqaisalpdyasqpg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1zm4C (C:)
    mvaftvdqmrslmdkvtnvrnmsviahvdhgkstltdslvqragiisaakagearftdtr
    kdeqergitikstaislysemsdedvkeikqktdgnsflinlidspghvdfssevtaalr
    vtdgalvvvdtiegvcvqtetvlrqalgerikpvvvinkvdrallelqvskedlyqtfar
    tvesvnvivstyadevlgdvqvypargtvafgsglhgwaftirqfatryakkfgvdkakm
    mdrlwgdsffnpktkkwtnkdtdaegkplerafnmfildpifrlftaimnfkkdeipvll
    ekleivlkgdekdlegkallkvvmrkflpaadallemivlhlpspvtaqayraeqlyegp
    addanciaikncdpkadlmlyvskmvptsdkgrfyafgrvfagtvksgqkvriqgpnyvp
    gkkddlfikaiqrvvlmmgrfvepiddcpagniiglvgidqfllktgtlttsetahnmkv
    mkfsvspvvqvavevknandlpklveglkrlsksdpcvltymsesgehivagtgelhlei
    clqdlehdhagvplkisppvvayretvesessqtalskspnkhnriylkaepideevsla
    iengiinprddfkararimaddygwdvtdarkiwcfgpdgngpnlvidqtkavqylheik
    dsvvaafqwatkegpifgeemrsvrvnildvtlhadaihrgggqiiptmrratyagflla
    dpkiqepvflveiqcpeqavggiysvlnkkrgqvvseeqrpgtplftvkaylpvnesfgf
    tgelrqatggqafpqmvfdhwstlgsdpldptskageivlaarkrhgmkeevpgwqeyyd
    kl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zm4C (C:)
    vaftvdqmrslmdkvtnvrnmsviahvdhgkstltdslvqragiisagitikstaislys
    emsdedvkeikqktdgnsflinlidspghvdfssevtaalrvtdgalvvvdtiegvcvqt
    etvlrqalgerikpvvvinkvdrallelqvskedlyqtfartvesvnvivstyadevlgd
    vqvypargtvafgsglhgwaftirqfatryakkfgvdkakmmdrlwgdsffnpktkkwtn
    kdtdaegkplerafnmfildpifrlftaimnfkkdeipvllekleivlkgdekdlegkal
    lkvvmrkflpaadallemivlhlpspvtaqayraeqlyegpaddanciaikncdpkadlm
    lyvskmvptsdkgrfyafgrvfagtvksgqkvriqgpnyvpgkkddlfikaiqrvvlmmg
    rfvepiddcpagniiglvgidqfllktgtlttsetahnmkvmkfsvspvvqvavevknan
    dlpklveglkrlsksdpcvltymsesgehivagtgelhleiclqdlehdhagvplkispp
    vvayretvesessqtalskspnkhnriylkaepideevslaiengiinprddfkararim
    addygwdvtdarkiwcfgpdgngpnlvidqtkavqylheikdsvvaafqwatkegpifge
    emrsvrvnildvtlhadaihrgggqiiptmrratyagflladpkiqepvflveiqcpeqa
    vggiysvlnkkrgqvvseeqrpgtplftvkaylpvnesfgftgelrqatggqafpqmvfd
    hwstlgsdpldptskageivlaarkrhgmkeevpgwqeyydkl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zm4D (D:)
    eflgdggdvsfstrgtqnwtverllqahrqleergyvfvgyhgtfleaaqsivfggvrar
    sqdldaiwrgfyiagdpalaygyaqdqepdargrirngallrvyvprsslpgfyrtsltl
    aapeaageverlighplplrldaitgpeeeggrletilgwplaertvvipsaiptdprnv
    ggdldpssipdkeqaisalpdyasqpg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1zm4E (E:)
    mvaftvdqmrslmdkvtnvrnmsviahvdhgkstltdslvqragiisaakagearftdtr
    kdeqergitikstaislysemsdedvkeikqktdgnsflinlidspghvdfssevtaalr
    vtdgalvvvdtiegvcvqtetvlrqalgerikpvvvinkvdrallelqvskedlyqtfar
    tvesvnvivstyadevlgdvqvypargtvafgsglhgwaftirqfatryakkfgvdkakm
    mdrlwgdsffnpktkkwtnkdtdaegkplerafnmfildpifrlftaimnfkkdeipvll
    ekleivlkgdekdlegkallkvvmrkflpaadallemivlhlpspvtaqayraeqlyegp
    addanciaikncdpkadlmlyvskmvptsdkgrfyafgrvfagtvksgqkvriqgpnyvp
    gkkddlfikaiqrvvlmmgrfvepiddcpagniiglvgidqfllktgtlttsetahnmkv
    mkfsvspvvqvavevknandlpklveglkrlsksdpcvltymsesgehivagtgelhlei
    clqdlehdhagvplkisppvvayretvesessqtalskspnkhnriylkaepideevsla
    iengiinprddfkararimaddygwdvtdarkiwcfgpdgngpnlvidqtkavqylheik
    dsvvaafqwatkegpifgeemrsvrvnildvtlhadaihrgggqiiptmrratyagflla
    dpkiqepvflveiqcpeqavggiysvlnkkrgqvvseeqrpgtplftvkaylpvnesfgf
    tgelrqatggqafpqmvfdhwstlgsdpldptskageivlaarkrhgmkeevpgwqeyyd
    kl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zm4E (E:)
    vaftvdqmrslmdkvtnvrnmsviahvdhgkstltdslvqragiisagitikstaislys
    emsdedvkeikqktdgnsflinlidspghvdfssevtaalrvtdgalvvvdtiegvcvqt
    etvlrqalgerikpvvvinkvdrallelqvskedlyqtfartvesvnvivstyadevlgd
    vqvypargtvafgsglhgwaftirqfatryakkfgvdkakmmdrlwgdsffnpktkkwtn
    kdtdaegkplerafnmfildpifrlftaimnfkkdeipvllekleivlkgdekdlegkal
    lkvvmrkflpaadallemivlhlpspvtaqayraeqlyegpaddanciaikncdpkadlm
    lyvskmvptsdkgrfyafgrvfagtvksgqkvriqgpnyvpgkkddlfikaiqrvvlmmg
    rfvepiddcpagniiglvgidqfllktgtlttsetahnmkvmkfsvspvvqvavevknan
    dlpklveglkrlsksdpcvltymsesgehivagtgelhleiclqdlehdhagvplkispp
    vvayretvesessqtalskspnkhnriylkaepideevslaiengiinprddfkararim
    addygwdvtdarkiwcfgpdgngpnlvidqtkavqylheikdsvvaafqwatkegpifge
    emrsvrvnildvtlhadaihrgggqiiptmrratyagflladpkiqepvflveiqcpeqa
    vggiysvlnkkrgqvvseeqrpgtplftvkaylpvnesfgftgelrqatggqafpqmvfd
    hwstlgsdpldptskageivlaarkrhgmkeevpgwqeyydkl
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zm4F (F:)
    eflgdggdvsfstrgtqnwtverllqahrqleergyvfvgyhgtfleaaqsivfggvrar
    sqdldaiwrgfyiagdpalaygyaqdqepdargrirngallrvyvprsslpgfyrtsltl
    aapeaageverlighplplrldaitgpeeeggrletilgwplaertvvipsaiptdprnv
    ggdldpssipdkeqaisalpdyasqpg