PDB entry 1zm3

View 1zm3 on RCSB PDB site
Description: Structure of the apo eEF2-ETA complex
Class: biosynthetic protein/transferase
Keywords: elongation factor, toxin, ADP-ribosylation, BIOSYNTHETIC PROTEIN/TRANSFERASE COMPLEX
Deposited on 2005-05-10, released 2005-05-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.07 Å
R-factor: 0.249
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Elongation factor 2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32324 (Start-841)
      • modified residue (698)
    Domains in SCOPe 2.06: d1zm3a1, d1zm3a2, d1zm3a3, d1zm3a4, d1zm3a5
  • Chain 'B':
    Compound: exotoxin a
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • GB AAB59097 (0-206)
    Domains in SCOPe 2.06: d1zm3b_
  • Chain 'C':
    Compound: Elongation factor 2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32324 (Start-841)
      • modified residue (698)
    Domains in SCOPe 2.06: d1zm3c1, d1zm3c2, d1zm3c3, d1zm3c4, d1zm3c5
  • Chain 'D':
    Compound: exotoxin a
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • GB AAB59097 (0-206)
    Domains in SCOPe 2.06: d1zm3d_
  • Chain 'E':
    Compound: Elongation factor 2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32324 (Start-841)
      • modified residue (698)
    Domains in SCOPe 2.06: d1zm3e1, d1zm3e2, d1zm3e3, d1zm3e4, d1zm3e5
  • Chain 'F':
    Compound: exotoxin a
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • GB AAB59097 (0-206)
    Domains in SCOPe 2.06: d1zm3f_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zm3A (A:)
    mvaftvdqmrslmdkvtnvrnmsviahvdhgkstltdslvqragiisaakagearftdtr
    kdeqergitikstaislysemsdedvkeikqktdgnsflinlidspghvdfssevtaalr
    vtdgalvvvdtiegvcvqtetvlrqalgerikpvvvinkvdrallelqvskedlyqtfar
    tvesvnvivstyadevlgdvqvypargtvafgsglhgwaftirqfatryakkfgvdkakm
    mdrlwgdsffnpktkkwtnkdtdaegkplerafnmfildpifrlftaimnfkkdeipvll
    ekleivlkgdekdlegkallkvvmrkflpaadallemivlhlpspvtaqayraeqlyegp
    addanciaikncdpkadlmlyvskmvptsdkgrfyafgrvfagtvksgqkvriqgpnyvp
    gkkddlfikaiqrvvlmmgrfvepiddcpagniiglvgidqfllktgtlttsetahnmkv
    mkfsvspvvqvavevknandlpklveglkrlsksdpcvltymsesgehivagtgelhlei
    clqdlehdhagvplkisppvvayretvesessqtalskspnkhnriylkaepideevsla
    iengiinprddfkararimaddygwdvtdarkiwcfgpdgngpnlvidqtkavqylheik
    dsvvaafqwatkegpifgeemrsvrvnildvtlhadaihrgggqiiptmrratyagflla
    dpkiqepvflveiqcpeqavggiysvlnkkrgqvvseeqrpgtplftvkaylpvnesfgf
    tgelrqatggqafpqmvfdhwstlgsdpldptskageivlaarkrhgmkeevpgwqeyyd
    kl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zm3A (A:)
    vaftvdqmrslmdkvtnvrnmsviahvdhgkstltdslvqragiisagitikstaislys
    emsdedvkeikqktdgnsflinlidspghvdfssevtaalrvtdgalvvvdtiegvcvqt
    etvlrqalgerikpvvvinkvdrallelqvskedlyqtfartvesvnvivstyadevlgd
    vqvypargtvafgsglhgwaftirqfatryakkfgvdkakmmdrlwgdsffnpktkkwtn
    kdtdaegkplerafnmfildpifrlftaimnfkkdeipvllekleivlkgdekdlegkal
    lkvvmrkflpaadallemivlhlpspvtaqayraeqlyegpaddanciaikncdpkadlm
    lyvskmvptsdkgrfyafgrvfagtvksgqkvriqgpnyvpgkkddlfikaiqrvvlmmg
    rfvepiddcpagniiglvgidqfllktgtlttsetahnmkvmkfsvspvvqvavevknan
    dlpklveglkrlsksdpcvltymsesgehivagtgelhleiclqdlehdhagvplkispp
    vvayretvesessqtalskspnkhnriylkaepideevslaiengiinprddfkararim
    addygwdvtdarkiwcfgpdgngpnlvidqtkavqylheikdsvvaafqwatkegpifge
    emrsvrvnildvtlhadaihrgggqiiptmrratyagflladpkiqepvflveiqcpeqa
    vggiysvlnkkrgqvvseeqrpgtplftvkaylpvnesfgftgelrqatggqafpqmvfd
    hwstlgsdpldptskageivlaarkrhgmkeevpgwqeyydkl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zm3B (B:)
    eflgdggdvsfstrgtqnwtverllqahrqleergyvfvgyhgtfleaaqsivfggvrar
    sqdldaiwrgfyiagdpalaygyaqdqepdargrirngallrvyvprsslpgfyrtsltl
    aapeaageverlighplplrldaitgpeeeggrletilgwplaertvvipsaiptdprnv
    ggdldpssipdkeqaisalpdyasqpg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1zm3C (C:)
    mvaftvdqmrslmdkvtnvrnmsviahvdhgkstltdslvqragiisaakagearftdtr
    kdeqergitikstaislysemsdedvkeikqktdgnsflinlidspghvdfssevtaalr
    vtdgalvvvdtiegvcvqtetvlrqalgerikpvvvinkvdrallelqvskedlyqtfar
    tvesvnvivstyadevlgdvqvypargtvafgsglhgwaftirqfatryakkfgvdkakm
    mdrlwgdsffnpktkkwtnkdtdaegkplerafnmfildpifrlftaimnfkkdeipvll
    ekleivlkgdekdlegkallkvvmrkflpaadallemivlhlpspvtaqayraeqlyegp
    addanciaikncdpkadlmlyvskmvptsdkgrfyafgrvfagtvksgqkvriqgpnyvp
    gkkddlfikaiqrvvlmmgrfvepiddcpagniiglvgidqfllktgtlttsetahnmkv
    mkfsvspvvqvavevknandlpklveglkrlsksdpcvltymsesgehivagtgelhlei
    clqdlehdhagvplkisppvvayretvesessqtalskspnkhnriylkaepideevsla
    iengiinprddfkararimaddygwdvtdarkiwcfgpdgngpnlvidqtkavqylheik
    dsvvaafqwatkegpifgeemrsvrvnildvtlhadaihrgggqiiptmrratyagflla
    dpkiqepvflveiqcpeqavggiysvlnkkrgqvvseeqrpgtplftvkaylpvnesfgf
    tgelrqatggqafpqmvfdhwstlgsdpldptskageivlaarkrhgmkeevpgwqeyyd
    kl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zm3C (C:)
    vaftvdqmrslmdkvtnvrnmsviahvdhgkstltdslvqragiisagitikstaislys
    emsdedvkeikqktdgnsflinlidspghvdfssevtaalrvtdgalvvvdtiegvcvqt
    etvlrqalgerikpvvvinkvdrallelqvskedlyqtfartvesvnvivstyadevlgd
    vqvypargtvafgsglhgwaftirqfatryakkfgvdkakmmdrlwgdsffnpktkkwtn
    kdtdaegkplerafnmfildpifrlftaimnfkkdeipvllekleivlkgdekdlegkal
    lkvvmrkflpaadallemivlhlpspvtaqayraeqlyegpaddanciaikncdpkadlm
    lyvskmvptsdkgrfyafgrvfagtvksgqkvriqgpnyvpgkkddlfikaiqrvvlmmg
    rfvepiddcpagniiglvgidqfllktgtlttsetahnmkvmkfsvspvvqvavevknan
    dlpklveglkrlsksdpcvltymsesgehivagtgelhleiclqdlehdhagvplkispp
    vvayretvesessqtalskspnkhnriylkaepideevslaiengiinprddfkararim
    addygwdvtdarkiwcfgpdgngpnlvidqtkavqylheikdsvvaafqwatkegpifge
    emrsvrvnildvtlhadaihrgggqiiptmrratyagflladpkiqepvflveiqcpeqa
    vggiysvlnkkrgqvvseeqrpgtplftvkaylpvnesfgftgelrqatggqafpqmvfd
    hwstlgsdpldptskageivlaarkrhgmkeevpgwqeyydkl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zm3D (D:)
    eflgdggdvsfstrgtqnwtverllqahrqleergyvfvgyhgtfleaaqsivfggvrar
    sqdldaiwrgfyiagdpalaygyaqdqepdargrirngallrvyvprsslpgfyrtsltl
    aapeaageverlighplplrldaitgpeeeggrletilgwplaertvvipsaiptdprnv
    ggdldpssipdkeqaisalpdyasqpg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1zm3E (E:)
    mvaftvdqmrslmdkvtnvrnmsviahvdhgkstltdslvqragiisaakagearftdtr
    kdeqergitikstaislysemsdedvkeikqktdgnsflinlidspghvdfssevtaalr
    vtdgalvvvdtiegvcvqtetvlrqalgerikpvvvinkvdrallelqvskedlyqtfar
    tvesvnvivstyadevlgdvqvypargtvafgsglhgwaftirqfatryakkfgvdkakm
    mdrlwgdsffnpktkkwtnkdtdaegkplerafnmfildpifrlftaimnfkkdeipvll
    ekleivlkgdekdlegkallkvvmrkflpaadallemivlhlpspvtaqayraeqlyegp
    addanciaikncdpkadlmlyvskmvptsdkgrfyafgrvfagtvksgqkvriqgpnyvp
    gkkddlfikaiqrvvlmmgrfvepiddcpagniiglvgidqfllktgtlttsetahnmkv
    mkfsvspvvqvavevknandlpklveglkrlsksdpcvltymsesgehivagtgelhlei
    clqdlehdhagvplkisppvvayretvesessqtalskspnkhnriylkaepideevsla
    iengiinprddfkararimaddygwdvtdarkiwcfgpdgngpnlvidqtkavqylheik
    dsvvaafqwatkegpifgeemrsvrvnildvtlhadaihrgggqiiptmrratyagflla
    dpkiqepvflveiqcpeqavggiysvlnkkrgqvvseeqrpgtplftvkaylpvnesfgf
    tgelrqatggqafpqmvfdhwstlgsdpldptskageivlaarkrhgmkeevpgwqeyyd
    kl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zm3E (E:)
    vaftvdqmrslmdkvtnvrnmsviahvdhgkstltdslvqragiisagitikstaislys
    emsdedvkeikqktdgnsflinlidspghvdfssevtaalrvtdgalvvvdtiegvcvqt
    etvlrqalgerikpvvvinkvdrallelqvskedlyqtfartvesvnvivstyadevlgd
    vqvypargtvafgsglhgwaftirqfatryakkfgvdkakmmdrlwgdsffnpktkkwtn
    kdtdaegkplerafnmfildpifrlftaimnfkkdeipvllekleivlkgdekdlegkal
    lkvvmrkflpaadallemivlhlpspvtaqayraeqlyegpaddanciaikncdpkadlm
    lyvskmvptsdkgrfyafgrvfagtvksgqkvriqgpnyvpgkkddlfikaiqrvvlmmg
    rfvepiddcpagniiglvgidqfllktgtlttsetahnmkvmkfsvspvvqvavevknan
    dlpklveglkrlsksdpcvltymsesgehivagtgelhleiclqdlehdhagvplkispp
    vvayretvesessqtalskspnkhnriylkaepideevslaiengiinprddfkararim
    addygwdvtdarkiwcfgpdgngpnlvidqtkavqylheikdsvvaafqwatkegpifge
    emrsvrvnildvtlhadaihrgggqiiptmrratyagflladpkiqepvflveiqcpeqa
    vggiysvlnkkrgqvvseeqrpgtplftvkaylpvnesfgftgelrqatggqafpqmvfd
    hwstlgsdpldptskageivlaarkrhgmkeevpgwqeyydkl
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zm3F (F:)
    eflgdggdvsfstrgtqnwtverllqahrqleergyvfvgyhgtfleaaqsivfggvrar
    sqdldaiwrgfyiagdpalaygyaqdqepdargrirngallrvyvprsslpgfyrtsltl
    aapeaageverlighplplrldaitgpeeeggrletilgwplaertvvipsaiptdprnv
    ggdldpssipdkeqaisalpdyasqpg