PDB entry 1zm2

View 1zm2 on RCSB PDB site
Description: Structure of ADP-ribosylated eEF2 in complex with catalytic fragment of ETA
Class: biosynthetic protein/transferase
Keywords: elongation factor, toxin, ADP-ribosylation, BIOSYNTHETIC PROTEIN/TRANSFERASE COMPLEX
Deposited on 2005-05-10, released 2005-05-24
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.07 Å
R-factor: 0.231
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Elongation factor 2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32324 (Start-841)
      • modified residue (698)
    Domains in SCOPe 2.04: d1zm2a1, d1zm2a2, d1zm2a3, d1zm2a4, d1zm2a5
  • Chain 'B':
    Compound: exotoxin a
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: eta
    Database cross-references and differences (RAF-indexed):
    • GB AAB59097 (0-206)
    Domains in SCOPe 2.04: d1zm2b_
  • Chain 'C':
    Compound: Elongation factor 2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32324 (Start-841)
      • modified residue (698)
    Domains in SCOPe 2.04: d1zm2c1, d1zm2c2, d1zm2c3, d1zm2c4, d1zm2c5
  • Chain 'D':
    Compound: exotoxin a
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: eta
    Database cross-references and differences (RAF-indexed):
    • GB AAB59097 (0-206)
    Domains in SCOPe 2.04: d1zm2d_
  • Chain 'E':
    Compound: Elongation factor 2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32324 (Start-841)
      • modified residue (698)
    Domains in SCOPe 2.04: d1zm2e1, d1zm2e2, d1zm2e3, d1zm2e4, d1zm2e5
  • Chain 'F':
    Compound: exotoxin a
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: eta
    Database cross-references and differences (RAF-indexed):
    • GB AAB59097 (0-206)
    Domains in SCOPe 2.04: d1zm2f_
  • Heterogens: APR

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zm2A (A:)
    mvaftvdqmrslmdkvtnvrnmsviahvdhgkstltdslvqragiisaakagearftdtr
    kdeqergitikstaislysemsdedvkeikqktdgnsflinlidspghvdfssevtaalr
    vtdgalvvvdtiegvcvqtetvlrqalgerikpvvvinkvdrallelqvskedlyqtfar
    tvesvnvivstyadevlgdvqvypargtvafgsglhgwaftirqfatryakkfgvdkakm
    mdrlwgdsffnpktkkwtnkdtdaegkplerafnmfildpifrlftaimnfkkdeipvll
    ekleivlkgdekdlegkallkvvmrkflpaadallemivlhlpspvtaqayraeqlyegp
    addanciaikncdpkadlmlyvskmvptsdkgrfyafgrvfagtvksgqkvriqgpnyvp
    gkkddlfikaiqrvvlmmgrfvepiddcpagniiglvgidqfllktgtlttsetahnmkv
    mkfsvspvvqvavevknandlpklveglkrlsksdpcvltymsesgehivagtgelhlei
    clqdlehdhagvplkisppvvayretvesessqtalskspnkhnriylkaepideevsla
    iengiinprddfkararimaddygwdvtdarkiwcfgpdgngpnlvidqtkavqylheik
    dsvvaafqwatkegpifgeemrsvrvnildvtlhadaihrgggqiiptmrratyagflla
    dpkiqepvflveiqcpeqavggiysvlnkkrgqvvseeqrpgtplftvkaylpvnesfgf
    tgelrqatggqafpqmvfdhwstlgsdpldptskageivlaarkrhgmkeevpgwqeyyd
    kl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zm2A (A:)
    vaftvdqmrslmdkvtnvrnmsviahvdhgkstltdslvqragiisagitikstaislys
    emsdedvkeikqktdgnsflinlidspghvdfssevtaalrvtdgalvvvdtiegvcvqt
    etvlrqalgerikpvvvinkvdrallelqvskedlyqtfartvesvnvivstyadevlgd
    vqvypargtvafgsglhgwaftirqfatryakkfgvdkakmmdrlwgdsffnpktkkwtn
    kdtdaegkplerafnmfildpifrlftaimnfkkdeipvllekleivlkgdekdlegkal
    lkvvmrkflpaadallemivlhlpspvtaqayraeqlyegpaddanciaikncdpkadlm
    lyvskmvptsdkgrfyafgrvfagtvksgqkvriqgpnyvpgkkddlfikaiqrvvlmmg
    rfvepiddcpagniiglvgidqfllktgtlttsetahnmkvmkfsvspvvqvavevknan
    dlpklveglkrlsksdpcvltymsesgehivagtgelhleiclqdlehdhagvplkispp
    vvayretvesessqtalskspnkhnriylkaepideevslaiengiinprddfkararim
    addygwdvtdarkiwcfgpdgngpnlvidqtkavqylheikdsvvaafqwatkegpifge
    emrsvrvnildvtlhadaihrgggqiiptmrratyagflladpkiqepvflveiqcpeqa
    vggiysvlnkkrgqvvseeqrpgtplftvkaylpvnesfgftgelrqatggqafpqmvfd
    hwstlgsdpldptskageivlaarkrhgmkeevpgwqeyydkl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zm2B (B:)
    eflgdggdvsfstrgtqnwtverllqahrqleergyvfvgyhgtfleaaqsivfggvrar
    sqdldaiwrgfyiagdpalaygyaqdqepdargrirngallrvyvprsslpgfyrtsltl
    aapeaageverlighplplrldaitgpeeeggrletilgwplaertvvipsaiptdprnv
    ggdldpssipdkeqaisalpdyasqpg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1zm2C (C:)
    mvaftvdqmrslmdkvtnvrnmsviahvdhgkstltdslvqragiisaakagearftdtr
    kdeqergitikstaislysemsdedvkeikqktdgnsflinlidspghvdfssevtaalr
    vtdgalvvvdtiegvcvqtetvlrqalgerikpvvvinkvdrallelqvskedlyqtfar
    tvesvnvivstyadevlgdvqvypargtvafgsglhgwaftirqfatryakkfgvdkakm
    mdrlwgdsffnpktkkwtnkdtdaegkplerafnmfildpifrlftaimnfkkdeipvll
    ekleivlkgdekdlegkallkvvmrkflpaadallemivlhlpspvtaqayraeqlyegp
    addanciaikncdpkadlmlyvskmvptsdkgrfyafgrvfagtvksgqkvriqgpnyvp
    gkkddlfikaiqrvvlmmgrfvepiddcpagniiglvgidqfllktgtlttsetahnmkv
    mkfsvspvvqvavevknandlpklveglkrlsksdpcvltymsesgehivagtgelhlei
    clqdlehdhagvplkisppvvayretvesessqtalskspnkhnriylkaepideevsla
    iengiinprddfkararimaddygwdvtdarkiwcfgpdgngpnlvidqtkavqylheik
    dsvvaafqwatkegpifgeemrsvrvnildvtlhadaihrgggqiiptmrratyagflla
    dpkiqepvflveiqcpeqavggiysvlnkkrgqvvseeqrpgtplftvkaylpvnesfgf
    tgelrqatggqafpqmvfdhwstlgsdpldptskageivlaarkrhgmkeevpgwqeyyd
    kl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zm2C (C:)
    vaftvdqmrslmdkvtnvrnmsviahvdhgkstltdslvqragiisagitikstaislys
    emsdedvkeikqktdgnsflinlidspghvdfssevtaalrvtdgalvvvdtiegvcvqt
    etvlrqalgerikpvvvinkvdrallelqvskedlyqtfartvesvnvivstyadevlgd
    vqvypargtvafgsglhgwaftirqfatryakkfgvdkakmmdrlwgdsffnpktkkwtn
    kdtdaegkplerafnmfildpifrlftaimnfkkdeipvllekleivlkgdekdlegkal
    lkvvmrkflpaadallemivlhlpspvtaqayraeqlyegpaddanciaikncdpkadlm
    lyvskmvptsdkgrfyafgrvfagtvksgqkvriqgpnyvpgkkddlfikaiqrvvlmmg
    rfvepiddcpagniiglvgidqfllktgtlttsetahnmkvmkfsvspvvqvavevknan
    dlpklveglkrlsksdpcvltymsesgehivagtgelhleiclqdlehdhagvplkispp
    vvayretvesessqtalskspnkhnriylkaepideevslaiengiinprddfkararim
    addygwdvtdarkiwcfgpdgngpnlvidqtkavqylheikdsvvaafqwatkegpifge
    emrsvrvnildvtlhadaihrgggqiiptmrratyagflladpkiqepvflveiqcpeqa
    vggiysvlnkkrgqvvseeqrpgtplftvkaylpvnesfgftgelrqatggqafpqmvfd
    hwstlgsdpldptskageivlaarkrhgmkeevpgwqeyydkl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zm2D (D:)
    eflgdggdvsfstrgtqnwtverllqahrqleergyvfvgyhgtfleaaqsivfggvrar
    sqdldaiwrgfyiagdpalaygyaqdqepdargrirngallrvyvprsslpgfyrtsltl
    aapeaageverlighplplrldaitgpeeeggrletilgwplaertvvipsaiptdprnv
    ggdldpssipdkeqaisalpdyasqpg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1zm2E (E:)
    mvaftvdqmrslmdkvtnvrnmsviahvdhgkstltdslvqragiisaakagearftdtr
    kdeqergitikstaislysemsdedvkeikqktdgnsflinlidspghvdfssevtaalr
    vtdgalvvvdtiegvcvqtetvlrqalgerikpvvvinkvdrallelqvskedlyqtfar
    tvesvnvivstyadevlgdvqvypargtvafgsglhgwaftirqfatryakkfgvdkakm
    mdrlwgdsffnpktkkwtnkdtdaegkplerafnmfildpifrlftaimnfkkdeipvll
    ekleivlkgdekdlegkallkvvmrkflpaadallemivlhlpspvtaqayraeqlyegp
    addanciaikncdpkadlmlyvskmvptsdkgrfyafgrvfagtvksgqkvriqgpnyvp
    gkkddlfikaiqrvvlmmgrfvepiddcpagniiglvgidqfllktgtlttsetahnmkv
    mkfsvspvvqvavevknandlpklveglkrlsksdpcvltymsesgehivagtgelhlei
    clqdlehdhagvplkisppvvayretvesessqtalskspnkhnriylkaepideevsla
    iengiinprddfkararimaddygwdvtdarkiwcfgpdgngpnlvidqtkavqylheik
    dsvvaafqwatkegpifgeemrsvrvnildvtlhadaihrgggqiiptmrratyagflla
    dpkiqepvflveiqcpeqavggiysvlnkkrgqvvseeqrpgtplftvkaylpvnesfgf
    tgelrqatggqafpqmvfdhwstlgsdpldptskageivlaarkrhgmkeevpgwqeyyd
    kl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zm2E (E:)
    vaftvdqmrslmdkvtnvrnmsviahvdhgkstltdslvqragiisagitikstaislys
    emsdedvkeikqktdgnsflinlidspghvdfssevtaalrvtdgalvvvdtiegvcvqt
    etvlrqalgerikpvvvinkvdrallelqvskedlyqtfartvesvnvivstyadevlgd
    vqvypargtvafgsglhgwaftirqfatryakkfgvdkakmmdrlwgdsffnpktkkwtn
    kdtdaegkplerafnmfildpifrlftaimnfkkdeipvllekleivlkgdekdlegkal
    lkvvmrkflpaadallemivlhlpspvtaqayraeqlyegpaddanciaikncdpkadlm
    lyvskmvptsdkgrfyafgrvfagtvksgqkvriqgpnyvpgkkddlfikaiqrvvlmmg
    rfvepiddcpagniiglvgidqfllktgtlttsetahnmkvmkfsvspvvqvavevknan
    dlpklveglkrlsksdpcvltymsesgehivagtgelhleiclqdlehdhagvplkispp
    vvayretvesessqtalskspnkhnriylkaepideevslaiengiinprddfkararim
    addygwdvtdarkiwcfgpdgngpnlvidqtkavqylheikdsvvaafqwatkegpifge
    emrsvrvnildvtlhadaihrgggqiiptmrratyagflladpkiqepvflveiqcpeqa
    vggiysvlnkkrgqvvseeqrpgtplftvkaylpvnesfgftgelrqatggqafpqmvfd
    hwstlgsdpldptskageivlaarkrhgmkeevpgwqeyydkl
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zm2F (F:)
    eflgdggdvsfstrgtqnwtverllqahrqleergyvfvgyhgtfleaaqsivfggvrar
    sqdldaiwrgfyiagdpalaygyaqdqepdargrirngallrvyvprsslpgfyrtsltl
    aapeaageverlighplplrldaitgpeeeggrletilgwplaertvvipsaiptdprnv
    ggdldpssipdkeqaisalpdyasqpg