PDB entry 1zm0

View 1zm0 on RCSB PDB site
Description: Crystal Structure of the Carboxyl Terminal PH Domain of Pleckstrin To 2.1 Angstroms
Class: lipid binding protein
Keywords: ph domain, beta sandwich, pleckstrin, lipid binding protein
Deposited on 2005-05-09, released 2006-02-28
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.236
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pleckstrin
    Species: Homo sapiens [TaxId:9606]
    Gene: PLEK, P47
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1zm0a1
  • Chain 'B':
    Compound: Pleckstrin
    Species: Homo sapiens [TaxId:9606]
    Gene: PLEK, P47
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1zm0b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zm0A (A:)
    gspefrgviikqgcllkqghrrknwkvrkfilredpaylhyydpagaedplgaihlrgcv
    vtsvesnsngrkseeenlfeiitadevhyflqaatpkertewikaiqmasrtgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zm0A (A:)
    gviikqgcllkqghrrknwkvrkfilredpaylhyydpagaedplgaihlrgcvvtsvee
    enlfeiitadevhyflqaatpkertewikaiqmasr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1zm0B (B:)
    gspefrgviikqgcllkqghrrknwkvrkfilredpaylhyydpagaedplgaihlrgcv
    vtsvesnsngrkseeenlfeiitadevhyflqaatpkertewikaiqmasrtgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zm0B (B:)
    rgviikqgcllkqghrrknwkvrkfilredpaylhyydpagaedplgaihlrgcvvtsve
    eeenlfeiitadevhyflqaatpkertewikaiqmasr