PDB entry 1zlz

View 1zlz on RCSB PDB site
Description: Re-Evaluation of the Low-Temperature Azide in Mn-Dependent Superoxide Dismutase
Class: oxidoreductase
Keywords: Azide derivative, manganese superoxide dismutase, localized mixed-valent dimer, OXIDOREDUCTASE
Deposited on 2005-05-09, released 2006-05-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.186
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: superoxide dismutase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00448 (0-204)
      • engineered (173)
    Domains in SCOPe 2.06: d1zlza1, d1zlza2
  • Chain 'B':
    Compound: superoxide dismutase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00448 (0-204)
      • engineered (173)
    Domains in SCOPe 2.06: d1zlzb1, d1zlzb2
  • Heterogens: AZI, MH2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zlzA (A:)
    sytlpslpyaydalephfdkqtmeihhtkhhqtyvnnanaaleslpefanlpveelitkl
    dqlpadkktvlrnnagghanhslfwkglkkgttlqgdlkaaierdfgsvdnfkaefekaa
    asrfgsgwawlvlkgdklavvstanqdsplmgeaisgasgfpimgldvwehayflkfqnr
    rpdyikefwnvvnwdeaaarfaakk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zlzB (B:)
    sytlpslpyaydalephfdkqtmeihhtkhhqtyvnnanaaleslpefanlpveelitkl
    dqlpadkktvlrnnagghanhslfwkglkkgttlqgdlkaaierdfgsvdnfkaefekaa
    asrfgsgwawlvlkgdklavvstanqdsplmgeaisgasgfpimgldvwehayflkfqnr
    rpdyikefwnvvnwdeaaarfaakk