PDB entry 1zl1

View 1zl1 on RCSB PDB site
Description: Crystal structure of the complex of signalling protein from sheep (SPS-40) with a designed peptide Trp-His-Trp reveals significance of Asn79 and Trp191 in the complex formation
Class: signaling protein
Keywords: signalling protein,complex trp-his-trp,crystal structure, signaling protein
Deposited on 2005-05-05, released 2005-05-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: 0.178
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chitinase-3 like protein 1
    Species: Ovis aries [TaxId:9940]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1zl1a1, d1zl1a2
  • Chain 'C':
    Compound: TRP-HIS-TRP peptide
    Species: synthetic, synthetic
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1ZL1 (0-2)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zl1A (A:)
    yklicyytswsqyregdgscfpdaidpflcthviysfanisnneidtwewndvtlydtln
    tlknrnpklktllsvggwnfgperfsaiasktqsrrtfiksvppflrthgfdgldlawly
    pgrrdkrhlttlvkemkaefireaqagteqlllsaavsagkiaidrgydiaqisrhldfi
    slltydfhgawrqtvghhsplfagnedassrfsnadyavsymlrlgapanklvmgiptfg
    rsftlassktdvgapvsgpgvpgrftkekgilayyeicdflhgatthrfrdqqvpyatkg
    nqwvayddqesvknkarylknrqlagamvwaldlddfrgtfcgqnltfpltsavkdvlae
    v
    

  • Chain 'C':
    No sequence available.