PDB entry 1zkh

View 1zkh on RCSB PDB site
Description: Solution structure of a human ubiquitin-like domain in SF3A1
Class: gene regulation
Keywords: UBIQUITIN, SPLICING FACTOR, Structural Genomics, Structural Genomics Consortium, SGC, GENE REGULATION
Deposited on 2005-05-02, released 2005-05-10
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Splicing factor 3 subunit 1
    Species: Homo sapiens [TaxId:9606]
    Gene: SF3A1, SAP114
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1zkha1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1zkhA (A:)
pvsikvqvpnmqdktewklngqvlvftlpltdqvsvikvkiheatgmpagkqklqyegif
ikdsnslayynmangavihlalkerg