PDB entry 1zka

View 1zka on RCSB PDB site
Description: NF-kB RelB forms an intertwined homodimer, Y300S mutant
Class: transcription
Keywords: Transcription factors, intertwined dimer, NF-kB dimerization, TRANSCRIPTION
Deposited on 2005-05-02, released 2005-05-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.206
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transcription factor relb
    Species: Mus musculus [TaxId:10090]
    Gene: Relb
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04863 (8-109)
      • cloning artifact (0-7)
      • engineered (31)
    Domains in SCOPe 2.06: d1zkaa1, d1zkaa2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zkaA (A:)
    lvprgshmntselricrinkesgpctggeelsllcdkvqkedisvvfstaswegradfsq
    advhrqiaivfktppyedleisepvtvnvflqrltdgvcseplpftylpr