PDB entry 1zk9

View 1zk9 on RCSB PDB site
Description: NF-kB RelB forms an intertwined homodimer
Class: transcription
Keywords: NF-kB, Transcription factors, intertwined dimer, TRANSCRIPTION
Deposited on 2005-05-02, released 2005-05-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.18 Å
R-factor: 0.195
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transcription factor relb
    Species: Mus musculus [TaxId:10090]
    Gene: Relb
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04863 (8-109)
      • cloning artifact (0-7)
    Domains in SCOPe 2.06: d1zk9a1, d1zk9a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zk9A (A:)
    lvprgshmntselricrinkesgpctggeelyllcdkvqkedisvvfstaswegradfsq
    advhrqiaivfktppyedleisepvtvnvflqrltdgvcseplpftylpr