PDB entry 1zjk

View 1zjk on RCSB PDB site
Description: Crystal structure of the zymogen catalytic region of human MASP-2
Class: hydrolase
Keywords: beta barrel, modular protein, HYDROLASE
Deposited on 2005-04-29, released 2005-07-26
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.18 Å
R-factor: 0.207
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mannan-binding lectin serine protease 2
    Species: Homo sapiens [TaxId:9606]
    Gene: MASP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot O00187 (Start-402)
      • engineered (160)
    Domains in SCOPe 2.03: d1zjka1, d1zjka2, d1zjka3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zjkA (A:)
    asmtgwkihytstahacpypmappnghvspvqakyilkdsfsifcetgyellqghlplks
    ftavcqkdgswdrpmpacsivdcgppddlpsgrveyitgpgvttykaviqysceetfytm
    kvndgkyvceadgfwtsskgekslpvcepvcglsarttggqiyggqkakpgdfpwqvlil
    ggttaagallydnwvltaahavyeqkhdasaldirmgtlkrlsphytqawseavfihegy
    thdagfdndialiklnnkvvinsnitpiclprkeaesfmrtddigtasgwgltqrgflar
    nlmyvdipivdhqkctaayekppyprgsvtanmlcaglesggkdscrgdsggalvfldse
    terwfvggivswgsmncgeagqygvytkvinyipwieniisdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zjkA (A:)
    tahacpypmappnghvspvqakyilkdsfsifcetgyellqghlplksftavcqkdgswd
    rpmpacsivdcgppddlpsgrveyitgpgvttykaviqysceetfytmkvndgkyvcead
    gfwtsskgekslpvcepvcglsarttggqiyggqkakpgdfpwqvlilggttaagallyd
    nwvltaahavyeqkhdasaldirmgtlkrlsphytqawseavfihegythdagfdndial
    iklnnkvvinsnitpiclprkeaesfmrtddigtasgwgltqrgflarnlmyvdipivdh
    qkctaayekppyprgsvtanmlcaglesggkdscrgdsggalvfldseterwfvggivsw
    gsmnceagqygvytkvinyipwieniisdf