PDB entry 1zj6

View 1zj6 on RCSB PDB site
Description: Crystal structure of human ARL5
Class: Transport Protein
Keywords: ARL, GTP-binding
Deposited on 2005-04-28, released 2005-06-07
The last revision prior to the SCOP 1.73 freeze date was dated 2005-06-21, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.212
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ADP-ribosylation factor-like protein 5
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1zj6a1
  • Heterogens: SO4, G3D, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zj6A (A:)
    mgilftriwrlfnhqehkviivgldnagkttilyqfsmnevvhtsptigsnveeivinnt
    rflmwdiggqeslrsswntyytntefvivvvdstdrerisvtreelykmlahedlrkagl
    lifankqdvkecmtvaeisqflkltsikdhqwhiqaccaltgeglcqglewmmsrlkirl
    ehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zj6A (A:)
    gilftriwrlfnhqehkviivgldnagkttilyqfsmnevvhtsptigsnveeivinntr
    flmwdiggrsswntyytntefvivvvdstdrerisvtreelykmlahedlrkagllifan
    kqdvkecmtvaeisqflkltsikdhqwhiqaccaltgeglcqglewmmsrlki