PDB entry 1zij

View 1zij on RCSB PDB site
Description: gcn4-leucine zipper core mutant asn16aba in the trimeric state
Class: leucine zipper
Keywords: leucine zipper, amino-acid biosynthesis, transcription regulation, activator, DNA-binding, nuclear protein, coiled coil
Deposited on 1996-10-30, released 1997-07-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.184
AEROSPACI score: -1.6 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: General control protein GCN4
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03069 (0-32)
    • modified residue (15)
  Domains in SCOPe 2.08: d1zija_
• Chain 'B':
  Compound: General control protein GCN4
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03069 (0-32)
    • modified residue (15)
  Domains in SCOPe 2.08: d1zijb_
• Chain 'C':
  Compound: General control protein GCN4
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03069 (0-32)
    • modified residue (15)
  Domains in SCOPe 2.08: d1zijc_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1zijA (A:)
  rmkqledkveellskayhlenevarlkklvger
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1zijB (B:)
  rmkqledkveellskayhlenevarlkklvger
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1zijC (C:)
  rmkqledkveellskayhlenevarlkklvger