PDB entry 1zib

View 1zib on RCSB PDB site
Description: reduced pseudoazurin
Class: electron transport
Keywords: cuproprotein, electron transport
Deposited on 1996-04-09, released 1997-04-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.169
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pseudoazurin
    Species: Achromobacter cycloclastes [TaxId:223]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ziba_
  • Heterogens: CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zibA (A:)
    adfevhmlnkgkdgamvfepaslkvapgdtvtfiptdkghnvetikgmipdgaeafkski
    nenykvtftapgvygvkctphygmgmvgvvqvgdapanleavkgaknpkkaqerldaala
    algn