PDB entry 1zhh

View 1zhh on RCSB PDB site
Description: Crystal Structure of the Apo Form of Vibrio Harveyi LUXP Complexed with the Periplasmic Domain of LUXQ
Class: Signaling Protein
Keywords: PERIPLASMIC BINDING PROTEIN, PER/ARNT/SIMPLE-MINDED (PAS) FOLD, AUTOINDUCER-2 (AI-2), QUORUM SENSING, SENSOR KINASE, Signaling Protein
Deposited on 2005-04-25, released 2005-05-24
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: 0.207
AEROSPACI score: -1.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Autoinducer 2-binding periplasmic protein luxP
    Species: Vibrio harveyi [TaxId:669]
    Gene: luxP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1zhha_
  • Chain 'B':
    Compound: Autoinducer 2 sensor kinase/phosphatase luxQ
    Species: Vibrio harveyi [TaxId:669]
    Gene: luxQ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1zhhb1
  • Heterogens: NHE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zhhA (A:)
    tqvlngywgyqefldefpeqrnltnalseavraqpvplskptqrpikisvvypgqqvsdy
    wvrniasfekrlyklninyqlnqvftrpnadikqqslslmealksksdyliftldttrhr
    kfvehvldstntklilqnittpvrewdkhqpflyvgfdhaegsrelatefgkffpkhtyy
    svlyfsegyisdvrgdtfihqvnrdnnfelqsayytkatkqsgydaakaslakhpdvdfi
    yacstdvalgavdalaelgredimingwgggsaeldaiqkgdlditvmrmnddtgiamae
    aikwdledkpvptvysgdfeivtkadsperiealkkrafrysdn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1zhhB (B:)
    gsyfskqiiwqevdrtkqqtsalihnifdshfaaiqihhdsnsksevirdfytdrdtdvl
    nffflsidqsdpshtpefrfltdhkgiiwddgnahfygvndlildslanrvsfsnnwyyi
    nvmtsigsrhmlvrrvpildpstgevlgfsfnavvldnnfalmeklksesnvdnvvlvan
    svplansligdepynvadvlqrkssdkrldkllvietpivvnavttelclltvqdnqsvv
    tl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zhhB (B:)
    rtkqqtsalihnifdshfaaiqihhdsnsksevirdfytdrdtdvlnffflsidqsdpsh
    tpefrfltdhkgiiwddgnahfygvndlildslanrvsfsnnwyyinvmtsigsrhmlvr
    rvpildpstgevlgfsfnavvldnnfalmeklksesnvdnvvlvansvplansligdepy
    nvadvlvietpivvnavttelclltvqd